DC900036

Overview
NameDC900036
Unique NameDC900036
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length508
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900036_ssr1 microsatellite DC900036_ssr1:1..20. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig6351 contig Csv1_Contig6351:103..610. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SMO2A_XENLA (Small ubiquitin-related modifier 2-A OS=Xenopus laevis GN=sumo2-A PE=3 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 7.307e-19
Identity = 48/90 (53.33%), Postives = 58/90 (64.44%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            P+E  K  N+   HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG
Sbjct:    6 PKEGVKTENND--HINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 93          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO2_XENTR (Small ubiquitin-related modifier 2 OS=Xenopus tropicalis GN=sumo2 PE=3 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 9.544e-19
Identity = 48/90 (53.33%), Postives = 58/90 (64.44%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            P+E  K  N+   HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG
Sbjct:    6 PKEGVKTENND--HINLKVAGQDGSVVQFKIKRHTPLNKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 93          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SMO2B_XENLA (Small ubiquitin-related modifier 2-B OS=Xenopus laevis GN=sumo2-B PE=3 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 9.544e-19
Identity = 48/90 (53.33%), Postives = 58/90 (64.44%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            P+E  K  N+   HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG
Sbjct:    6 PKEGVKTENND--HINLKVAGQDGSVVQFKIKRHTPLNKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 93          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO2_DANRE (Small ubiquitin-related modifier 2 OS=Danio rerio GN=sumo2 PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.246e-18
Identity = 48/90 (53.33%), Postives = 58/90 (64.44%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            P+E  K  N+   HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG
Sbjct:    6 PKEGVKTENND--HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLTMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 93          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO1_SPETR (Small ubiquitin-related modifier 1 OS=Spermophilus tridecemlineatus GN=SUMO1 PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 4.736e-18
Identity = 44/97 (45.36%), Postives = 59/97 (60.82%), Query Frame = 1
Query:   37 MSGVTNTPQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            MS     P  ED     +  +I LKV GQD +E+ F++K +T LKKL  +YC RQ V +NS+ FLF+G+R+    TP EL ME+ D I+    QTGG
Sbjct:    1 MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG 97          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO1_RAT (Small ubiquitin-related modifier 1 OS=Rattus norvegicus GN=Sumo1 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 4.736e-18
Identity = 44/97 (45.36%), Postives = 59/97 (60.82%), Query Frame = 1
Query:   37 MSGVTNTPQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            MS     P  ED     +  +I LKV GQD +E+ F++K +T LKKL  +YC RQ V +NS+ FLF+G+R+    TP EL ME+ D I+    QTGG
Sbjct:    1 MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG 97          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO1_PONAB (Small ubiquitin-related modifier 1 OS=Pongo abelii GN=SUMO1 PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 4.736e-18
Identity = 44/97 (45.36%), Postives = 59/97 (60.82%), Query Frame = 1
Query:   37 MSGVTNTPQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            MS     P  ED     +  +I LKV GQD +E+ F++K +T LKKL  +YC RQ V +NS+ FLF+G+R+    TP EL ME+ D I+    QTGG
Sbjct:    1 MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG 97          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO1_PIG (Small ubiquitin-related modifier 1 OS=Sus scrofa GN=SUMO1 PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 4.736e-18
Identity = 44/97 (45.36%), Postives = 59/97 (60.82%), Query Frame = 1
Query:   37 MSGVTNTPQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            MS     P  ED     +  +I LKV GQD +E+ F++K +T LKKL  +YC RQ V +NS+ FLF+G+R+    TP EL ME+ D I+    QTGG
Sbjct:    1 MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG 97          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO1_MOUSE (Small ubiquitin-related modifier 1 OS=Mus musculus GN=Sumo1 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 4.736e-18
Identity = 44/97 (45.36%), Postives = 59/97 (60.82%), Query Frame = 1
Query:   37 MSGVTNTPQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            MS     P  ED     +  +I LKV GQD +E+ F++K +T LKKL  +YC RQ V +NS+ FLF+G+R+    TP EL ME+ D I+    QTGG
Sbjct:    1 MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG 97          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO1_HUMAN (Small ubiquitin-related modifier 1 OS=Homo sapiens GN=SUMO1 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 4.736e-18
Identity = 44/97 (45.36%), Postives = 59/97 (60.82%), Query Frame = 1
Query:   37 MSGVTNTPQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            MS     P  ED     +  +I LKV GQD +E+ F++K +T LKKL  +YC RQ V +NS+ FLF+G+R+    TP EL ME+ D I+    QTGG
Sbjct:    1 MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG 97          
The following BLAST results are available for this feature:
BLAST of DC900036 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
SMO2A_XENLA7.307e-1953.33Small ubiquitin-related modifier 2-A OS=Xenopus la... [more]
SUMO2_XENTR9.544e-1953.33Small ubiquitin-related modifier 2 OS=Xenopus trop... [more]
SMO2B_XENLA9.544e-1953.33Small ubiquitin-related modifier 2-B OS=Xenopus la... [more]
SUMO2_DANRE1.246e-1853.33Small ubiquitin-related modifier 2 OS=Danio rerio ... [more]
SUMO1_SPETR4.736e-1845.36Small ubiquitin-related modifier 1 OS=Spermophilus... [more]
SUMO1_RAT4.736e-1845.36Small ubiquitin-related modifier 1 OS=Rattus norve... [more]
SUMO1_PONAB4.736e-1845.36Small ubiquitin-related modifier 1 OS=Pongo abelii... [more]
SUMO1_PIG4.736e-1845.36Small ubiquitin-related modifier 1 OS=Sus scrofa G... [more]
SUMO1_MOUSE4.736e-1845.36Small ubiquitin-related modifier 1 OS=Mus musculus... [more]
SUMO1_HUMAN4.736e-1845.36Small ubiquitin-related modifier 1 OS=Homo sapiens... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900036 VSS Citrus sinensis cDNA clone VS27Q44 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900036 ID=DC900036|Name=DC900036|organism=Citrus sinensis|type=EST|length=508bp
GAGAGAGAGAGAGAGAGAGACGAAGCAGAAGAGAGAATGTCAGGCGTCAC
GAACACTCCGCAAGAGGAAGATAAGAAGCCCAACGATCAATCGGCTCACA
TCAATCTCAAAGTCAAGGGCCAGGATGGGAATGAGGTTTTCTTCAGGATC
AAACGAAGCACCCAACTAAAGAAGCTTATGAATGCATACTGTGATAGACA
ATCTGTGGAGCTGAACTCAATTGCCTTCTTGTTTGATGGCCGCCGTCTTC
GAGGAGAGCAAACCCCTGATGAGCTGGAAATGGAAGATGGTGATGAGATT
GATGCCATGCTGCACCAAACCGGAGGAATGCTGATGTTCTAATTATGTAA
TGCTCGTTTGAGAGCTTATTAGTAGTATTAATGTAAAACTATTTATGGAT
GGATGTAAGTTATGCAGAGGCTCAAGATTGTGTATTTGTGATCTACACCA
TTATGTTTGGATTACCTAAGTATGTAGCTCTTTCTTCAAGAGCCCTGATC
GTTGCGGT
back to top