DC900036

Overview
NameDC900036
Unique NameDC900036
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length508
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900036_ssr1 microsatellite DC900036_ssr1:1..20. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig6351 contig Csv1_Contig6351:103..610. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO1_CHICK (Small ubiquitin-related modifier 1 OS=Gallus gallus GN=SUMO1 PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 4.736e-18
Identity = 44/97 (45.36%), Postives = 59/97 (60.82%), Query Frame = 1
Query:   37 MSGVTNTPQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            MS     P  ED     +  +I LKV GQD +E+ F++K +T LKKL  +YC RQ V +NS+ FLF+G+R+    TP EL ME+ D I+    QTGG
Sbjct:    1 MSDQEAKPSAEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRITDNHTPKELGMEEEDVIEVYQEQTGG 97          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO1_BOVIN (Small ubiquitin-related modifier 1 OS=Bos taurus GN=SUMO1 PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 4.736e-18
Identity = 44/97 (45.36%), Postives = 59/97 (60.82%), Query Frame = 1
Query:   37 MSGVTNTPQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            MS     P  ED     +  +I LKV GQD +E+ F++K +T LKKL  +YC RQ V +NS+ FLF+G+R+    TP EL ME+ D I+    QTGG
Sbjct:    1 MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG 97          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO1_CERNI (Small ubiquitin-related modifier 1 OS=Cervus nippon GN=SUMO1 PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 6.186e-18
Identity = 44/97 (45.36%), Postives = 59/97 (60.82%), Query Frame = 1
Query:   37 MSGVTNTPQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            MS     P  ED     +  +I LKV GQD +E+ F++K +T LKKL  +YC RQ V +NS+ FLF+G+R+    TP EL ME+ D I+    QTGG
Sbjct:    1 MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYHEQTGG 97          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO1_XENTR (Small ubiquitin-related modifier 1 OS=Xenopus tropicalis GN=sumo1 PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.800e-17
Identity = 45/98 (45.92%), Postives = 60/98 (61.22%), Query Frame = 1
Query:   37 MSGVTNTPQEEDKKPNDQSA-HINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            MS     P  ED     +   +I LKV GQD +E+ F++K +T LKKL  +YC RQ V +NS+ FLF+G+R+   QTP EL ME+ D I+    QTGG
Sbjct:    1 MSDQEAKPSSEDLGDKKEGGDYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRISDHQTPKELGMEEEDVIEVYQEQTGG 98          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SMO1B_XENLA (Small ubiquitin-related modifier 1-B OS=Xenopus laevis GN=sumo1-B PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.800e-17
Identity = 45/98 (45.92%), Postives = 60/98 (61.22%), Query Frame = 1
Query:   37 MSGVTNTPQEEDKKPNDQSA-HINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            MS     P  ED     +   +I LKV GQD +E+ F++K +T LKKL  +YC RQ V +NS+ FLF+G+R+   QTP EL ME+ D I+    QTGG
Sbjct:    1 MSDQEAKPSSEDLGDKKEGGDYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRISDHQTPKELGMEEEDVIEVYQEQTGG 98          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO_CAEEL (Small ubiquitin-related modifier OS=Caenorhabditis elegans GN=smo-1 PE=1 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 4.010e-17
Identity = 41/88 (46.59%), Postives = 55/88 (62.50%), Query Frame = 1
Query:   64 EEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            ++  +  D + +I +KV GQD NEV FR+K  T + KL  +Y DR  V +NS+ FLFDGRR+  + TP  LEMED D I+    Q GG
Sbjct:    3 DDAAQAGDNAEYIKIKVVGQDSNEVHFRVKYGTSMAKLKKSYADRTGVAVNSLRFLFDGRRINDDDTPKTLEMEDDDVIEVYQEQLGG 90          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO4_PIG (Small ubiquitin-related modifier 4 OS=Sus scrofa GN=SUMO4 PE=1 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 4.010e-17
Identity = 44/91 (48.35%), Postives = 58/91 (63.74%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGM 330
            P+E  K  N+   HINLKV GQDG+   F+I+R T L KLM AYC+RQ + +  I F  DG+ +    TP +LE+ED D ID +  QTGG+
Sbjct:    6 PKEGVKTENND--HINLKVAGQDGSVAQFKIRRHTPLSKLMKAYCERQGLSIRQIRFRVDGQPINETHTPAQLELEDEDTIDVLQQQTGGV 94          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO4_HUMAN (Small ubiquitin-related modifier 4 OS=Homo sapiens GN=SUMO4 PE=1 SV=2)

HSP 1 Score: 86.6557 bits (213), Expect = 6.839e-17
Identity = 45/91 (49.45%), Postives = 56/91 (61.54%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGM 330
            P EE K  N+   HINLKV GQDG+ V F+IKR T L KLM AYC+ + + +  I F F G+ + G   P +LEMED D ID     TGG+
Sbjct:    6 PTEEVKTENNN--HINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSMKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGV 94          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO1_ONCMY (Small ubiquitin-related modifier 1 OS=Oncorhynchus mykiss GN=sumo1 PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.524e-16
Identity = 41/98 (41.84%), Postives = 58/98 (59.18%), Query Frame = 1
Query:   37 MSGVTNTPQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGM 330
            MS     P  +D        +I LKV GQD +E+ F++K +T LKKL  +Y  RQ V ++++ FLF+G+R+    TP EL MED D I+    QTGG+
Sbjct:    1 MSDTDTKPSGQDGGDQKDGEYIKLKVIGQDNSEIHFKVKMTTHLKKLKESYSQRQGVHMSTLRFLFEGQRISDNHTPKELGMEDEDVIEVYQEQTGGL 98          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SMO1A_XENLA (Small ubiquitin-related modifier 1-A OS=Xenopus laevis GN=sumo1-A PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.990e-16
Identity = 46/102 (45.10%), Postives = 60/102 (58.82%), Query Frame = 1
Query:   37 MSGVTNTPQEEDK-KPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGMLMF 339
            MS     P  ED     D   +I LKV GQD +E+ F++K +T LKKL  +Y  RQ V +NS+ FLF+G+R+   QTP EL ME+ D I+    QTGG   F
Sbjct:    1 MSDQEAKPSSEDLGDKKDGGDYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYRQRQGVPMNSLRFLFEGQRISDHQTPKELGMEEEDVIEVYQEQTGGHSTF 102          
The following BLAST results are available for this feature:
BLAST of DC900036 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
SUMO1_CHICK4.736e-1845.36Small ubiquitin-related modifier 1 OS=Gallus gallu... [more]
SUMO1_BOVIN4.736e-1845.36Small ubiquitin-related modifier 1 OS=Bos taurus G... [more]
SUMO1_CERNI6.186e-1845.36Small ubiquitin-related modifier 1 OS=Cervus nippo... [more]
SUMO1_XENTR1.800e-1745.92Small ubiquitin-related modifier 1 OS=Xenopus trop... [more]
SMO1B_XENLA1.800e-1745.92Small ubiquitin-related modifier 1-B OS=Xenopus la... [more]
SUMO_CAEEL4.010e-1746.59Small ubiquitin-related modifier OS=Caenorhabditis... [more]
SUMO4_PIG4.010e-1748.35Small ubiquitin-related modifier 4 OS=Sus scrofa G... [more]
SUMO4_HUMAN6.839e-1749.45Small ubiquitin-related modifier 4 OS=Homo sapiens... [more]
SUMO1_ONCMY1.524e-1641.84Small ubiquitin-related modifier 1 OS=Oncorhynchus... [more]
SMO1A_XENLA1.990e-1645.10Small ubiquitin-related modifier 1-A OS=Xenopus la... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900036 VSS Citrus sinensis cDNA clone VS27Q44 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900036 ID=DC900036|Name=DC900036|organism=Citrus sinensis|type=EST|length=508bp
GAGAGAGAGAGAGAGAGAGACGAAGCAGAAGAGAGAATGTCAGGCGTCAC
GAACACTCCGCAAGAGGAAGATAAGAAGCCCAACGATCAATCGGCTCACA
TCAATCTCAAAGTCAAGGGCCAGGATGGGAATGAGGTTTTCTTCAGGATC
AAACGAAGCACCCAACTAAAGAAGCTTATGAATGCATACTGTGATAGACA
ATCTGTGGAGCTGAACTCAATTGCCTTCTTGTTTGATGGCCGCCGTCTTC
GAGGAGAGCAAACCCCTGATGAGCTGGAAATGGAAGATGGTGATGAGATT
GATGCCATGCTGCACCAAACCGGAGGAATGCTGATGTTCTAATTATGTAA
TGCTCGTTTGAGAGCTTATTAGTAGTATTAATGTAAAACTATTTATGGAT
GGATGTAAGTTATGCAGAGGCTCAAGATTGTGTATTTGTGATCTACACCA
TTATGTTTGGATTACCTAAGTATGTAGCTCTTTCTTCAAGAGCCCTGATC
GTTGCGGT
back to top