DC900036

Overview
NameDC900036
Unique NameDC900036
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length508
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900036_ssr1 microsatellite DC900036_ssr1:1..20. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig6351 contig Csv1_Contig6351:103..610. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO1_DANRE (Small ubiquitin-related modifier 1 OS=Danio rerio GN=sumo1 PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 3.394e-16
Identity = 42/93 (45.16%), Postives = 55/93 (59.14%), Query Frame = 1
Query:   49 TNTPQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            T T    D        +I LKV GQD +E+ F++K +T LKKL  +Y  RQ V +NS+ FLF+G+R+    TP EL MED D I+    QTGG
Sbjct:    4 TETKPSSDGGEKKDGEYIKLKVIGQDNSEIHFKVKMTTHLKKLKESYSQRQGVPVNSLRFLFEGQRITDNLTPKELGMEDEDVIEVYQEQTGG 96          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SMT3_YEAST (Ubiquitin-like protein SMT3 OS=Saccharomyces cerevisiae GN=SMT3 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 5.790e-16
Identity = 44/97 (45.36%), Postives = 64/97 (65.98%), Query Frame = 1
Query:   40 SGVTNTPQEEDKKPNDQSAHINLKVKGQDGN-EVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            S V    + E K       HINLKV   DG+ E+FF+IK++T L++LM A+  RQ  E++S+ FL+DG R++ +QTP++L+MED D I+A   Q GG
Sbjct:    4 SEVNQEAKPEVKPEVKPETHINLKVS--DGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG 98          
The following BLAST results are available for this feature:
BLAST of DC900036 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
SUMO1_DANRE3.394e-1645.16Small ubiquitin-related modifier 1 OS=Danio rerio ... [more]
SMT3_YEAST5.790e-1645.36Ubiquitin-like protein SMT3 OS=Saccharomyces cerev... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900036 VSS Citrus sinensis cDNA clone VS27Q44 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900036 ID=DC900036|Name=DC900036|organism=Citrus sinensis|type=EST|length=508bp
GAGAGAGAGAGAGAGAGAGACGAAGCAGAAGAGAGAATGTCAGGCGTCAC
GAACACTCCGCAAGAGGAAGATAAGAAGCCCAACGATCAATCGGCTCACA
TCAATCTCAAAGTCAAGGGCCAGGATGGGAATGAGGTTTTCTTCAGGATC
AAACGAAGCACCCAACTAAAGAAGCTTATGAATGCATACTGTGATAGACA
ATCTGTGGAGCTGAACTCAATTGCCTTCTTGTTTGATGGCCGCCGTCTTC
GAGGAGAGCAAACCCCTGATGAGCTGGAAATGGAAGATGGTGATGAGATT
GATGCCATGCTGCACCAAACCGGAGGAATGCTGATGTTCTAATTATGTAA
TGCTCGTTTGAGAGCTTATTAGTAGTATTAATGTAAAACTATTTATGGAT
GGATGTAAGTTATGCAGAGGCTCAAGATTGTGTATTTGTGATCTACACCA
TTATGTTTGGATTACCTAAGTATGTAGCTCTTTCTTCAAGAGCCCTGATC
GTTGCGGT
back to top