DC900035

Overview
NameDC900035
Unique NameDC900035
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length436
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLTP2_SOLCI (Non-specific lipid-transfer protein 2 OS=Solanum chilense PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 7.466e-12
Identity = 32/68 (47.06%), Postives = 40/68 (58.82%), Query Frame = 3
Query:   15 PSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 218
            P   CC GV+ L     TT DRQAAC C+K AA+ +  + L KA  LP  C V+I   I+P  DCSK+
Sbjct:   46 PLGGCCGGVKGLLGQAQTTVDRQAACACLKSAASSFTDLDLGKAASLPSTCNVNIPYKISPSTDCSKV 113          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLTP1_SORBI (Non-specific lipid-transfer protein 1 OS=Sorghum bicolor GN=LTP1 PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 7.466e-12
Identity = 30/69 (43.48%), Postives = 41/69 (59.42%), Query Frame = 3
Query:   15 PSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 221
            PS  CC+GV  L     TTADR+AAC C+K+AA    G+    A  +P +CGV +   I+   DCS++S
Sbjct:   50 PSAGCCSGVRSLNSAARTTADRRAACNCLKNAARGISGLNAGNAASIPSKCGVSVPYTISTSTDCSRVS 118          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLTP_PINTA (Non-specific lipid-transfer protein OS=Pinus taeda PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.663e-11
Identity = 33/71 (46.48%), Postives = 42/71 (59.15%), Query Frame = 3
Query:    9 AKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGV-DIGVPITPDIDCSKI 218
            A P+  CC  +  L      T DRQA C C+K  A  Y G+KL KA  LP  C V D+ VPI+P++DCSK+
Sbjct:   53 ATPAATCCPSIRGLDSQVKATPDRQAVCNCLKTQAKSY-GVKLGKAANLPGLCKVTDLNVPISPNVDCSKV 122          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLT22_PARJU (Probable non-specific lipid-transfer protein 2 OS=Parietaria judaica PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 2.172e-11
Identity = 31/72 (43.06%), Postives = 45/72 (62.50%), Query Frame = 3
Query:    6 EAKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGV-PITPDIDCSKI 218
            E +PS++CC+G + L +   TT  ++ ACKCI  A     GIK +   ++PK+CG+   + PIT D DCSKI
Sbjct:   53 EKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLPPITADFDCSKI 124          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLTP1_HELAN (Non-specific lipid-transfer protein AP10 OS=Helianthus annuus PE=1 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 2.837e-11
Identity = 30/69 (43.48%), Postives = 44/69 (63.77%), Query Frame = 3
Query:   12 KPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 218
            KP+ ACC G + L   T T ADR+ ACKC K AA + + ++ D A  LP +CG+   +PI P+++C+ I
Sbjct:   48 KPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCGISTSIPINPNVNCNTI 115          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLTP1_SOLLC (Non-specific lipid-transfer protein 1 OS=Solanum lycopersicum GN=TSW12 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.705e-11
Identity = 31/68 (45.59%), Postives = 41/68 (60.29%), Query Frame = 3
Query:   15 PSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 218
            P   CC GV+ L  +  TTADR+ AC C+K AA   +GI L+KA  +P  C V+I   I+P  DCS +
Sbjct:   46 PLGGCCGGVKNLLGSAKTTADRKTACTCLKSAANAIKGIDLNKAAGIPSVCKVNIPYKISPSTDCSTV 113          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: LTP1_MORNI (Non-specific lipid-transfer protein 1 OS=Morus nigra PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.705e-11
Identity = 29/64 (45.31%), Postives = 38/64 (59.38%), Query Frame = 3
Query:   27 CCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 218
            CC GV  L +   TTADRQAAC C+K A    +G+ L+ A  LP +CGV +   I+P  DC  +
Sbjct:   27 CCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSV 90          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLTP_HELAN (Non-specific lipid-transfer protein OS=Helianthus annuus PE=3 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.839e-11
Identity = 30/65 (46.15%), Postives = 37/65 (56.92%), Query Frame = 3
Query:   24 ACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 218
            ACC+GV+ L     TT DRQAAC C+K A     G+    A   P +CGV I   I+P  DCSK+
Sbjct:   51 ACCSGVKSLNSAAKTTPDRQAACGCLKSAYNSISGVNAGNAASFPGKCGVSIPYKISPSTDCSKV 115          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLTP1_SOLPN (Non-specific lipid-transfer protein 1 OS=Solanum pennellii GN=LTP1 PE=3 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.839e-11
Identity = 31/68 (45.59%), Postives = 41/68 (60.29%), Query Frame = 3
Query:   15 PSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 218
            P   CC GV+ L  +  TTADR+ AC C+K AA   +GI L+KA  +P  C V+I   I+P  DCS +
Sbjct:   46 PLGGCCGGVKGLLGSAKTTADRKTACTCLKSAANAIKGIDLNKAAGIPSVCKVNIPYKISPSTDCSTV 113          
The following BLAST results are available for this feature:
BLAST of DC900035 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 29
Match NameE-valueIdentityDescription
NLTP2_SOLCI7.466e-1247.06Non-specific lipid-transfer protein 2 OS=Solanum c... [more]
NLTP1_SORBI7.466e-1243.48Non-specific lipid-transfer protein 1 OS=Sorghum b... [more]
NLTP_PINTA1.663e-1146.48Non-specific lipid-transfer protein OS=Pinus taeda... [more]
NLT22_PARJU2.172e-1143.06Probable non-specific lipid-transfer protein 2 OS=... [more]
NLTP1_HELAN2.837e-1143.48Non-specific lipid-transfer protein AP10 OS=Helian... [more]
NLTP1_SOLLC3.705e-1145.59Non-specific lipid-transfer protein 1 OS=Solanum l... [more]
LTP1_MORNI3.705e-1145.31Non-specific lipid-transfer protein 1 OS=Morus nig... [more]
NLTP_HELAN4.839e-1146.15Non-specific lipid-transfer protein OS=Helianthus ... [more]
NLTP1_SOLPN4.839e-1145.59Non-specific lipid-transfer protein 1 OS=Solanum p... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900035 VSS Citrus sinensis cDNA clone VS27Q43 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900035 ID=DC900035|Name=DC900035|organism=Citrus sinensis|type=EST|length=436bp
CCGGGGAAGCCAAGCCATCTCGGGCATGCTGCACTGGTGTCGAGTATCTG
AAAGACAACACTCCAACAACTGCAGACAGGCAAGCTGCTTGTAAATGCAT
CAAAGATGCGGCAACTCGCTATCGCGGCATCAAGCTGGACAAAGCTCGTC
AACTCCCCAAAGAATGTGGCGTCGACATTGGCGTTCCCATCACCCCCGAT
ATCGACTGTAGCAAAATTTCTTAGAACCCCCCACGGAGGCTTTGAGCTTG
TGCGTTGAATAAACTTCTCTGCCTGGAGAAAACACAGCACAATTAGTACA
CATGATCTAATTATGCTTGTTAATTTATGCTGCTTGTTATGGTTCTTGCT
GAAGAACTTTTGTATCGGGATACTTATAGTGCATGGTGTTTTGGCACATA
ATTAGCGTTAATAAAACTACAGTTATTACCTCTACC
back to top