CN185787
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CN185787 vs. ExPASy Swiss-Prot
Match: HOX18_ORYSI (Homeobox-leucine zipper protein HOX18 OS=Oryza sativa subsp. indica GN=HOX18 PE=2 SV=1) HSP 1 Score: 81.2629 bits (199), Expect = 5.511e-15 Identity = 40/58 (68.97%), Postives = 46/58 (79.31%), Query Frame = 1 Query: 517 GVNARKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFPNRRART 690 G RKKL+LTKEQS LLE+SF+ H+ L+ QK LARQL L+PRQVEVWF NRRART Sbjct: 110 GGGTRKKLQLTKEQSTLLEDSFRVHNILSHAQKHELARQLKLKPRQVEVWFQNRRART 167
BLAST of CN185787 vs. ExPASy Swiss-Prot
Match: ATHBX_ARATH (Homeobox-leucine zipper protein ATHB-X OS=Arabidopsis thaliana GN=ATHB-X PE=2 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 1.603e-14 Identity = 42/63 (66.67%), Postives = 46/63 (73.02%), Query Frame = 1 Query: 502 DEDEDGVNARKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFPNRRART 690 D+ G RKKLRLTKEQS LLEESF Q+ TL PKQK+ LA L L RQVEVWF NRRAR+ Sbjct: 59 DDSNSGGRRRKKLRLTKEQSHLLEESFIQNHTLTPKQKKDLATFLKLSQRQVEVWFQNRRARS 121
BLAST of CN185787 vs. ExPASy Swiss-Prot
Match: HOX26_ORYSJ (Putative homeobox-leucine zipper protein HOX26 OS=Oryza sativa subsp. japonica GN=HOX26 PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 1.149e-12 Identity = 38/61 (62.30%), Postives = 47/61 (77.05%), Query Frame = 1 Query: 508 DEDGVNARKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFPNRRART 690 DE+G + RKKLRLT EQ+ LLE+SF+ H+ L+ +KQ LA +L L RQVEVWF NRRART Sbjct: 110 DEEGAS-RKKLRLTGEQATLLEDSFRAHNILSHAEKQELAGKLGLSARQVEVWFQNRRART 169 The following BLAST results are available for this feature:
BLAST of CN185787 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 33
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CN185787 ID=CN185787; Name=CN185787; organism=Citrus sinensis; type=EST; length=692bpback to top |