DC900030

Overview
NameDC900030
Unique NameDC900030
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length703
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4784 contig Csv1_Contig4784:168..869. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2D1_MOUSE (Ubiquitin-conjugating enzyme E2 D1 OS=Mus musculus GN=Ube2d1 PE=2 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 8.380e-67
Identity = 113/147 (76.87%), Postives = 128/147 (87.07%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            MA KRI KEL DLQ+DPPA CSAGPV DD+FHWQATIMGP DS + GGVF +++HFP DYPFKPPK+AF TK++HPNINSNGSICLDIL+ QWSPALT+SKVLLSICSLL DPNPDDPLVP+IA +YK+D+ KY   AR WTQKYAM
Sbjct:    1 MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2D1_HUMAN (Ubiquitin-conjugating enzyme E2 D1 OS=Homo sapiens GN=UBE2D1 PE=1 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 8.380e-67
Identity = 113/147 (76.87%), Postives = 128/147 (87.07%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            MA KRI KEL DLQ+DPPA CSAGPV DD+FHWQATIMGP DS + GGVF +++HFP DYPFKPPK+AF TK++HPNINSNGSICLDIL+ QWSPALT+SKVLLSICSLL DPNPDDPLVP+IA +YK+D+ KY   AR WTQKYAM
Sbjct:    1 MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2D1_BOVIN (Ubiquitin-conjugating enzyme E2 D1 OS=Bos taurus GN=UBE2D1 PE=2 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 8.380e-67
Identity = 113/147 (76.87%), Postives = 128/147 (87.07%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            MA KRI KEL DLQ+DPPA CSAGPV DD+FHWQATIMGP DS + GGVF +++HFP DYPFKPPK+AF TK++HPNINSNGSICLDIL+ QWSPALT+SKVLLSICSLL DPNPDDPLVP+IA +YK+D+ KY   AR WTQKYAM
Sbjct:    1 MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: U2D2B_RAT (Ubiquitin-conjugating enzyme E2 D2B OS=Rattus norvegicus GN=Ube2d2b PE=2 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 2.696e-65
Identity = 113/147 (76.87%), Postives = 127/147 (86.39%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            MA KRI+KEL DL +DPPA CSAGPV +DMFHWQATIMGP+DSP+ GG F ++I FP +YPFKPPKV F T+++HPN+NSNGSICLDIL+ QWSPALTISKVLLSI SLL DPNPDDPLVPEIA +YKTDR KY  TAR WTQKYAM
Sbjct:    1 MALKRIHKELNDLAQDPPAQCSAGPVGEDMFHWQATIMGPNDSPYQGGAFFLTIDFPTEYPFKPPKVEFTTRIYHPNVNSNGSICLDILRSQWSPALTISKVLLSISSLLCDPNPDDPLVPEIAQIYKTDRDKYNRTAREWTQKYAM 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: U2D2B_MOUSE (Ubiquitin-conjugating enzyme E2 D2B OS=Mus musculus GN=Ube2d2b PE=2 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 2.696e-65
Identity = 113/147 (76.87%), Postives = 127/147 (86.39%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            MA KRI+KEL DL +DPPA CSAGPV +DMFHWQATIMGP+DSP+ GG F ++I FP +YPFKPPKV F T+++HPN+NSNGSICLDIL+ QWSPALTISKVLLSI SLL DPNPDDPLVPEIA +YKTDR KY  TAR WTQKYAM
Sbjct:    1 MALKRIHKELNDLAQDPPAQCSAGPVGEDMFHWQATIMGPNDSPYQGGAFFLTIDFPTEYPFKPPKVEFTTRIYHPNVNSNGSICLDILRSQWSPALTISKVLLSISSLLCDPNPDDPLVPEIAQIYKTDRDKYNRTAREWTQKYAM 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2E1_MOUSE (Ubiquitin-conjugating enzyme E2 E1 OS=Mus musculus GN=Ube2e1 PE=2 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 6.446e-51
Identity = 96/157 (61.15%), Postives = 119/157 (75.80%), Query Frame = 2
Query:   14 SQAPKLLRNSQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 484
            S+  KLL  S   +KRI KEL D+  DPP +CSAGP  D+++ W++TI+GP  S + GGVF + I F P+YPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISKVLLSICSLLTD NP DPLV  IA  Y T+RA+++  AR WT++YA
Sbjct:   39 SKNSKLLSTS---AKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 192          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2E1_HUMAN (Ubiquitin-conjugating enzyme E2 E1 OS=Homo sapiens GN=UBE2E1 PE=1 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 6.446e-51
Identity = 96/157 (61.15%), Postives = 119/157 (75.80%), Query Frame = 2
Query:   14 SQAPKLLRNSQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 484
            S+  KLL  S   +KRI KEL D+  DPP +CSAGP  D+++ W++TI+GP  S + GGVF + I F P+YPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISKVLLSICSLLTD NP DPLV  IA  Y T+RA+++  AR WT++YA
Sbjct:   39 SKNSKLLSTS---AKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 192          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2E2_MOUSE (Ubiquitin-conjugating enzyme E2 E2 OS=Mus musculus GN=Ube2e2 PE=2 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 1.436e-50
Identity = 91/145 (62.76%), Postives = 114/145 (78.62%), Query Frame = 2
Query:   50 ASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 484
            ++KRI KEL ++  DPP +CSAGP  D+++ W++TI+GP  S + GGVF + I F PDYPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISKVLLSICSLLTD NP DPLV  IA  Y T+RA+++  AR WT++YA
Sbjct:   56 SAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 200          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2E2_HUMAN (Ubiquitin-conjugating enzyme E2 E2 OS=Homo sapiens GN=UBE2E2 PE=1 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 1.436e-50
Identity = 91/145 (62.76%), Postives = 114/145 (78.62%), Query Frame = 2
Query:   50 ASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 484
            ++KRI KEL ++  DPP +CSAGP  D+++ W++TI+GP  S + GGVF + I F PDYPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISKVLLSICSLLTD NP DPLV  IA  Y T+RA+++  AR WT++YA
Sbjct:   56 SAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 200          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBCD2_DROME (Ubiquitin-conjugating enzyme E2-24 kDa OS=Drosophila melanogaster GN=UbcD2 PE=1 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 3.199e-50
Identity = 91/154 (59.09%), Postives = 116/154 (75.32%), Query Frame = 2
Query:   23 PKLLRNSQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 484
            P++ R    ++KRI KEL ++  DPP +CSAGP  D+++ W +TI+GP  S + GGVF + IHF P+YPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISKVLLSICSLLTD NP DPLV  IA  Y  +R +++  AR WT++YA
Sbjct:   78 PRISRALGTSAKRIQKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQNREEHDRIARLWTKRYA 231          
The following BLAST results are available for this feature:
BLAST of DC900030 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UB2D1_MOUSE8.380e-6776.87Ubiquitin-conjugating enzyme E2 D1 OS=Mus musculus... [more]
UB2D1_HUMAN8.380e-6776.87Ubiquitin-conjugating enzyme E2 D1 OS=Homo sapiens... [more]
UB2D1_BOVIN8.380e-6776.87Ubiquitin-conjugating enzyme E2 D1 OS=Bos taurus G... [more]
U2D2B_RAT2.696e-6576.87Ubiquitin-conjugating enzyme E2 D2B OS=Rattus norv... [more]
U2D2B_MOUSE2.696e-6576.87Ubiquitin-conjugating enzyme E2 D2B OS=Mus musculu... [more]
UB2E1_MOUSE6.446e-5161.15Ubiquitin-conjugating enzyme E2 E1 OS=Mus musculus... [more]
UB2E1_HUMAN6.446e-5161.15Ubiquitin-conjugating enzyme E2 E1 OS=Homo sapiens... [more]
UB2E2_MOUSE1.436e-5062.76Ubiquitin-conjugating enzyme E2 E2 OS=Mus musculus... [more]
UB2E2_HUMAN1.436e-5062.76Ubiquitin-conjugating enzyme E2 E2 OS=Homo sapiens... [more]
UBCD2_DROME3.199e-5059.09Ubiquitin-conjugating enzyme E2-24 kDa OS=Drosophi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900030 VSS Citrus sinensis cDNA clone VS27Q38 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900030 ID=DC900030|Name=DC900030|organism=Citrus sinensis|type=EST|length=703bp
AGCCAGACCCAACTCTCAGGCCCCAAAGTTGTTGAGAAATTCCCAGATGG
CTTCAAAACGGATCAACAAGGAGTTGAAGGATCTACAGAAGGACCCTCCT
GCTTCTTGTAGCGCTGGCCCTGTTGCTGATGACATGTTCCATTGGCAAGC
AACAATTATGGGCCCATCAGACAGCCCATTTGCTGGGGGTGTATTTCTTG
TATCCATTCATTTCCCACCTGATTATCCATTCAAGCCACCGAAGGTGGCC
TTCCGTACTAAGGTTTTCCACCCTAACATCAACAGCAATGGTAGCATCTG
TCTTGACATTCTCAAGGAGCAGTGGAGCCCTGCTTTGACAATATCCAAGG
TACTTCTGTCAATTTGCTCACTACTTACTGATCCGAACCCAGATGACCCA
CTTGTGCCTGAGATTGCTCACATGTACAAGACTGACAGAGCCAAATATGA
GACTACTGCTCGATCCTGGACTCAGAAGTATGCCATGGGTTAAGAGGGGC
TAGGCTGTATGCCCCTGAGAACATTAATGGCTTGTGGTCCTATTAGTAAA
TAATAGAAATAAGTTTGTTTCAGATATTAAAAGACGATATTTGGTTTTGT
TTACTAAGTTGTTAAAAGGTTTTATGTGGGGTTACTTTCAAATTTAGCAT
TGTTCTTCAATACTTAAATTATAATTTACTGCAGAATTGAGCTGCCTTTG
CCT
back to top