DC900030

Overview
NameDC900030
Unique NameDC900030
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length703
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4784 contig Csv1_Contig4784:168..869. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBE2N_DICDI (Probable ubiquitin-conjugating enzyme E2 N OS=Dictyostelium discoideum GN=ube2n PE=3 SV=2)

HSP 1 Score: 147.902 bits (372), Expect = 4.958e-35
Identity = 72/143 (50.35%), Postives = 93/143 (65.03%), Query Frame = 2
Query:   56 KRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 484
            KRI KE + L  +P    SA P  D+  +++  I GP DSPF GGVF + +    DYP   PKV F TK++HPNI+  G ICLDILK++WSPAL I  VLLSI +LL+ PNPDDPL  ++A  +KT+  +    AR WT+ YA
Sbjct:    6 KRIIKETQRLMTEPAPGISATPATDNFRYFKVAISGPLDSPFEGGVFNLELFLTDDYPMSAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEHWKTNEKEAMARAREWTRLYA 148          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC36_ARATH (Ubiquitin carrier protein E2 36 OS=Arabidopsis thaliana GN=UBC36 PE=1 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 4.958e-35
Identity = 71/145 (48.97%), Postives = 97/145 (66.90%), Query Frame = 2
Query:   56 KRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 490
            +RI KE + L  +P    SA P  ++M ++   I+GP+ SP+ GGVF + +  P +YP   PKV F TK++HPNI+  G ICLDILK++WSPAL I  VLLSI +LL+ PNPDDPL   IA  +K++ A+   TA+ WT+ YA G
Sbjct:    8 RRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASG 152          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBE2N_PONAB (Ubiquitin-conjugating enzyme E2 N OS=Pongo abelii GN=UBE2N PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.105e-34
Identity = 70/144 (48.61%), Postives = 94/144 (65.28%), Query Frame = 2
Query:   56 KRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            +RI KE + L  +P     A P   +  ++   I GP DSPF GG F + +  P +YP   PKV F TK++HPN++  G ICLDILK++WSPAL I  VLLSI +LL+ PNPDDPL  ++A  +KT+ A+   TAR+WT+ YAM
Sbjct:    6 RRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAM 149          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBE2N_MOUSE (Ubiquitin-conjugating enzyme E2 N OS=Mus musculus GN=Ube2n PE=1 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.105e-34
Identity = 70/144 (48.61%), Postives = 94/144 (65.28%), Query Frame = 2
Query:   56 KRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            +RI KE + L  +P     A P   +  ++   I GP DSPF GG F + +  P +YP   PKV F TK++HPN++  G ICLDILK++WSPAL I  VLLSI +LL+ PNPDDPL  ++A  +KT+ A+   TAR+WT+ YAM
Sbjct:    6 RRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAM 149          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBE2N_HUMAN (Ubiquitin-conjugating enzyme E2 N OS=Homo sapiens GN=UBE2N PE=1 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.105e-34
Identity = 70/144 (48.61%), Postives = 94/144 (65.28%), Query Frame = 2
Query:   56 KRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            +RI KE + L  +P     A P   +  ++   I GP DSPF GG F + +  P +YP   PKV F TK++HPN++  G ICLDILK++WSPAL I  VLLSI +LL+ PNPDDPL  ++A  +KT+ A+   TAR+WT+ YAM
Sbjct:    6 RRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAM 149          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBE2N_BOVIN (Ubiquitin-conjugating enzyme E2 N OS=Bos taurus GN=UBE2N PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.105e-34
Identity = 70/144 (48.61%), Postives = 94/144 (65.28%), Query Frame = 2
Query:   56 KRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            +RI KE + L  +P     A P   +  ++   I GP DSPF GG F + +  P +YP   PKV F TK++HPN++  G ICLDILK++WSPAL I  VLLSI +LL+ PNPDDPL  ++A  +KT+ A+   TAR+WT+ YAM
Sbjct:    6 RRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAM 149          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBE2N_RAT (Ubiquitin-conjugating enzyme E2 N OS=Rattus norvegicus GN=Ube2n PE=1 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 3.214e-34
Identity = 69/144 (47.92%), Postives = 94/144 (65.28%), Query Frame = 2
Query:   56 KRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            +RI KE + L  +P     A P   +  ++   I GP DSPF GG F + +  P +YP   PKV F TK++HPN++  G ICLDILK++WSPAL I  VLLSI +LL+ PNPDDPL  ++A  +K++ A+   TAR+WT+ YAM
Sbjct:    6 RRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKSNEAQAIETARAWTRLYAM 149          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC3_ARATH (Ubiquitin-conjugating enzyme E2 3 OS=Arabidopsis thaliana GN=UBC3 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 3.214e-34
Identity = 66/133 (49.62%), Postives = 89/133 (66.92%), Query Frame = 2
Query:   50 ASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY 448
            A KR+  + K LQKDPP   S  P  +++ HW A I GP D+P+ GG F +++HF  DYP KPP V F +++FHPNI ++GSICLDIL+ QWSP   ++ VL SI SLL DPNPD P   E A ++  ++ +Y
Sbjct:    5 AKKRLMWDFKRLQKDPPVGISGAPQDNNIMHWNALIFGPEDTPWDGGTFKLTLHFTEDYPNKPPIVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAVLTSIQSLLCDPNPDSPANAEAARLFSENKREY 137          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC1_ARATH (Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis thaliana GN=UBC1 PE=1 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 4.198e-34
Identity = 70/149 (46.98%), Postives = 93/149 (62.42%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTAR-----SWT 472
            S  A KR+ ++ K LQ+DPPA  S  P  +++  W A I GP D+P+ GG F +S+ F  DYP KPP V F +++FHPNI ++GSICLDIL+ QWSP   ++ +L SI SLL DPNP+ P   E A MY   + +Y    R     SWT
Sbjct:    2 STPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMYSESKREYNRRVRDVVEQSWT 150          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC1_SCHPO (Ubiquitin-conjugating enzyme E2 1 OS=Schizosaccharomyces pombe GN=ubc1 PE=2 SV=2)

HSP 1 Score: 144.436 bits (363), Expect = 5.482e-34
Identity = 68/155 (43.87%), Postives = 96/155 (61.94%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG*EGL 502
            S   S+RI KEL D+Q+D  A      + DD+ H +    GP  +P+ GG F+V I  P DYPF+PPK+ F TK++HPN++S  G+ICLDILK+QWSP  T+   L+S+ SLL  P P +P   ++A +Y  +  ++  TAR WT  YA    G+
Sbjct:    2 SDNRSRRIAKELADVQQDKQAGIQVWTINDDISHLKGMFRGPEGTPYEGGYFVVDIEIPIDYPFRPPKMNFDTKIYHPNVSSQTGAICLDILKDQWSPVYTMKSALISLQSLLCTPEPSNPQDAQVAQVYLQNYQQFVRTAREWTSSYAAAPAGV 156          
The following BLAST results are available for this feature:
BLAST of DC900030 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UBE2N_DICDI4.958e-3550.35Probable ubiquitin-conjugating enzyme E2 N OS=Dict... [more]
UBC36_ARATH4.958e-3548.97Ubiquitin carrier protein E2 36 OS=Arabidopsis tha... [more]
UBE2N_PONAB1.105e-3448.61Ubiquitin-conjugating enzyme E2 N OS=Pongo abelii ... [more]
UBE2N_MOUSE1.105e-3448.61Ubiquitin-conjugating enzyme E2 N OS=Mus musculus ... [more]
UBE2N_HUMAN1.105e-3448.61Ubiquitin-conjugating enzyme E2 N OS=Homo sapiens ... [more]
UBE2N_BOVIN1.105e-3448.61Ubiquitin-conjugating enzyme E2 N OS=Bos taurus GN... [more]
UBE2N_RAT3.214e-3447.92Ubiquitin-conjugating enzyme E2 N OS=Rattus norveg... [more]
UBC3_ARATH3.214e-3449.62Ubiquitin-conjugating enzyme E2 3 OS=Arabidopsis t... [more]
UBC1_ARATH4.198e-3446.98Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis t... [more]
UBC1_SCHPO5.482e-3443.87Ubiquitin-conjugating enzyme E2 1 OS=Schizosacchar... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900030 VSS Citrus sinensis cDNA clone VS27Q38 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900030 ID=DC900030|Name=DC900030|organism=Citrus sinensis|type=EST|length=703bp
AGCCAGACCCAACTCTCAGGCCCCAAAGTTGTTGAGAAATTCCCAGATGG
CTTCAAAACGGATCAACAAGGAGTTGAAGGATCTACAGAAGGACCCTCCT
GCTTCTTGTAGCGCTGGCCCTGTTGCTGATGACATGTTCCATTGGCAAGC
AACAATTATGGGCCCATCAGACAGCCCATTTGCTGGGGGTGTATTTCTTG
TATCCATTCATTTCCCACCTGATTATCCATTCAAGCCACCGAAGGTGGCC
TTCCGTACTAAGGTTTTCCACCCTAACATCAACAGCAATGGTAGCATCTG
TCTTGACATTCTCAAGGAGCAGTGGAGCCCTGCTTTGACAATATCCAAGG
TACTTCTGTCAATTTGCTCACTACTTACTGATCCGAACCCAGATGACCCA
CTTGTGCCTGAGATTGCTCACATGTACAAGACTGACAGAGCCAAATATGA
GACTACTGCTCGATCCTGGACTCAGAAGTATGCCATGGGTTAAGAGGGGC
TAGGCTGTATGCCCCTGAGAACATTAATGGCTTGTGGTCCTATTAGTAAA
TAATAGAAATAAGTTTGTTTCAGATATTAAAAGACGATATTTGGTTTTGT
TTACTAAGTTGTTAAAAGGTTTTATGTGGGGTTACTTTCAAATTTAGCAT
TGTTCTTCAATACTTAAATTATAATTTACTGCAGAATTGAGCTGCCTTTG
CCT
back to top