DC900030

Overview
NameDC900030
Unique NameDC900030
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length703
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4784 contig Csv1_Contig4784:168..869. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC2_ARATH (Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis thaliana GN=UBC2 PE=2 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 7.160e-34
Identity = 69/149 (46.31%), Postives = 94/149 (63.09%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY-----ETTARSWT 472
            S  A KR+ ++ K LQ+DPPA  S  P  +++  W A I GP D+P+ GG F +S+ F  DYP KPP V F +++FHPNI ++GSICLDIL+ QWSP   ++ +L SI SLL DPNP+ P   E A M+   + +Y     E   +SWT
Sbjct:    2 STPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSESKREYNRRVREVVEQSWT 150          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC2_WHEAT (Ubiquitin-conjugating enzyme E2 2 OS=Triticum aestivum GN=UBC2 PE=1 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 9.351e-34
Identity = 69/149 (46.31%), Postives = 95/149 (63.76%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY-----ETTARSWT 472
            S  A KR+ ++ K LQ+DPPA  S  P  +++  W A I GP D+P+ GG F +++ F  DYP KPP V F +++FHPNI ++GSICLDIL+ QWSP   ++ +L SI SLL DPNP+ P   E A MY  ++ +Y     E   +SWT
Sbjct:    2 STPARKRLMRDFKRLQQDPPAGISGAPHDNNITLWNAVIFGPDDTPWDGGTFKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWT 150          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC2_MEDSA (Ubiquitin-conjugating enzyme E2 2 OS=Medicago sativa GN=UBC2 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 9.351e-34
Identity = 69/149 (46.31%), Postives = 94/149 (63.09%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY-----ETTARSWT 472
            S  A KR+ ++ K LQ DPPA  S  P  +++  W A I GP D+P+ GG F +S+ F  DYP KPP V F +++FHPNI ++GSICLDIL+ QWSP   ++ +L SI SLL DPNP+ P   E A M+  ++ +Y     E   +SWT
Sbjct:    2 STPARKRLMRDFKRLQHDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYNRRVREVVEQSWT 150          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC2_ASPFU (Ubiquitin-conjugating enzyme E2 2 OS=Aspergillus fumigatus GN=ubc2 PE=3 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.221e-33
Identity = 66/148 (44.59%), Postives = 94/148 (63.51%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY-----ETTARSW 469
            S  A +R+ ++ K +Q DPPA  SA PVAD++  W A I+GP+D+PF  G F + +HF   YP KPP V F +++FHPN+   G +CLDIL+ +WSP   ++ +L SI SLL DPN   P   E +++YK +R +Y     ET  +SW
Sbjct:    2 STSARRRLMRDFKRMQTDPPAGVSASPVADNVMTWNAVIIGPADTPFEDGTFRLVMHFEEQYPNKPPGVKFISQMFHPNVYGTGELCLDILQNRWSPTYDVAAILTSIQSLLNDPNTSSPANVEASNLYKDNRKEYIKRVRETVEKSW 149          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC2_TRIHA (Ubiquitin-conjugating enzyme E2 2 OS=Trichoderma harzianum GN=UBC2 PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.595e-33
Identity = 66/148 (44.59%), Postives = 95/148 (64.19%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY-----ETTARSW 469
            S  A +R+ ++ K +Q DPPA  SA P+ D++  W A I+GP+D+PF  G F + + F   YP KPP+V F +++FHPN+ +NG +CLDIL+ +WSP   ++ VL SI SLL DPN   P   E +++YK +R +Y     ET  RSW
Sbjct:    2 STAARRRLMRDFKRMQTDPPAGVSASPIPDNVMTWNAVIIGPADTPFEDGTFRLVMQFEEQYPNKPPQVKFISQMFHPNVYANGELCLDILQNRWSPTYDVAAVLTSIQSLLNDPNTGSPANVEASNLYKDNRREYIKRVRETVERSW 149          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC2_EMENI (Ubiquitin-conjugating enzyme E2 2 OS=Emericella nidulans GN=uvsJ PE=3 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 2.083e-33
Identity = 65/150 (43.33%), Postives = 95/150 (63.33%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY-----ETTARSWTQ 475
            S  A +R+ ++ K +Q DPPA  SA PVAD++  W A I+GP+D+PF  G F + +HF   YP KPP V F +++FHPN+   G +CLDIL+ +WSP   ++ +L SI SLL DPN   P   E +++Y+ +R +Y     ET  +SW +
Sbjct:    2 STSARRRLMRDFKRMQTDPPAGVSASPVADNVMTWNAVIIGPADTPFEDGTFRLVMHFEEQYPNKPPGVKFISQMFHPNVYGTGELCLDILQNRWSPTYDVAAILTSIQSLLNDPNTSSPANVEASNLYRDNRKEYIKRVRETVEKSWEE 151          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBCD6_DROME (Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster GN=UbcD6 PE=2 SV=2)

HSP 1 Score: 141.354 bits (355), Expect = 4.641e-33
Identity = 64/146 (43.84%), Postives = 93/146 (63.70%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQK 478
            S  A +R+ ++ K LQ+DPP   S  P  +++  W A I GP D+PF  G F ++I F  +YP KPP V F +KVFHPN+ ++G ICLDIL+ +WSP   +S +L SI SLL+DPNP+ P     A +YK +R +YE   ++  ++
Sbjct:    2 STPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQ 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC13_SCHPO (Ubiquitin-conjugating enzyme E2 13 OS=Schizosaccharomyces pombe GN=ubc13 PE=1 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 6.061e-33
Identity = 65/144 (45.14%), Postives = 93/144 (64.58%), Query Frame = 2
Query:   56 KRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            KRI KE++ L +DPP    A P  D++ +++ T+ GP  S + GG F + +  P +YP  PP V F TK++HPN++  G ICL  LK+ WSPAL I  VLLSI +L+  PNPDDPL  ++A ++K +  +    AR WT+KYA+
Sbjct:    5 KRIIKEIETLTRDPPPGIVAAPTEDNLRYFKITMEGPQQSAYEGGKFHLELFLPDEYPMMPPNVRFLTKIYHPNVDKLGRICLSTLKKDWSPALQIRTVLLSIQALMGAPNPDDPLDNDVAKIWKENEPQAIANAREWTKKYAV 148          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC1_YEAST (Ubiquitin-conjugating enzyme E2-24 kDa OS=Saccharomyces cerevisiae GN=UBC1 PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 7.916e-33
Identity = 68/146 (46.58%), Postives = 96/146 (65.75%), Query Frame = 2
Query:   53 SKRINKELKDLQKDPPASCSAGPVAD-DMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 484
            +KRI KE++ ++ DP A  +   V++ D+ H + T +GP  +P+ GG F+V I  P +YPFKPPK+ F TKV+HPNI+S  G+ICLDILK  WSP +T+   L+S+ +LL  P P+DP   E+A  Y  DR  +  TA  WT+ YA
Sbjct:    4 AKRIMKEIQAVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPFKPPKMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLRDRESFNKTAALWTRLYA 149          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC2_NECHA (Ubiquitin-conjugating enzyme E2 2 OS=Nectria haematococca GN=UBC2 PE=3 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.350e-32
Identity = 65/148 (43.92%), Postives = 94/148 (63.51%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY-----ETTARSW 469
            S  A +R+ ++ K +Q DPPA  SA PV D++  W A I+GP+D+PF  G F + + F   YP KPP+V F +++FHPN+ + G +CLDIL+ +WSP   ++ VL SI SLL DPN   P   E +++YK +R +Y     ET  +SW
Sbjct:    2 STAARRRLMRDFKRMQTDPPAGVSASPVPDNVMTWNAVIIGPADTPFEDGTFRLVMQFEEQYPNKPPQVKFISEMFHPNVYATGELCLDILQNRWSPTYDVAAVLTSIQSLLNDPNTGSPANVEASNLYKDNRKEYTKRVRETVEKSW 149          
The following BLAST results are available for this feature:
BLAST of DC900030 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UBC2_ARATH7.160e-3446.31Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis t... [more]
UBC2_WHEAT9.351e-3446.31Ubiquitin-conjugating enzyme E2 2 OS=Triticum aest... [more]
UBC2_MEDSA9.351e-3446.31Ubiquitin-conjugating enzyme E2 2 OS=Medicago sati... [more]
UBC2_ASPFU1.221e-3344.59Ubiquitin-conjugating enzyme E2 2 OS=Aspergillus f... [more]
UBC2_TRIHA1.595e-3344.59Ubiquitin-conjugating enzyme E2 2 OS=Trichoderma h... [more]
UBC2_EMENI2.083e-3343.33Ubiquitin-conjugating enzyme E2 2 OS=Emericella ni... [more]
UBCD6_DROME4.641e-3343.84Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophi... [more]
UBC13_SCHPO6.061e-3345.14Ubiquitin-conjugating enzyme E2 13 OS=Schizosaccha... [more]
UBC1_YEAST7.916e-3346.58Ubiquitin-conjugating enzyme E2-24 kDa OS=Saccharo... [more]
UBC2_NECHA1.350e-3243.92Ubiquitin-conjugating enzyme E2 2 OS=Nectria haema... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900030 VSS Citrus sinensis cDNA clone VS27Q38 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900030 ID=DC900030|Name=DC900030|organism=Citrus sinensis|type=EST|length=703bp
AGCCAGACCCAACTCTCAGGCCCCAAAGTTGTTGAGAAATTCCCAGATGG
CTTCAAAACGGATCAACAAGGAGTTGAAGGATCTACAGAAGGACCCTCCT
GCTTCTTGTAGCGCTGGCCCTGTTGCTGATGACATGTTCCATTGGCAAGC
AACAATTATGGGCCCATCAGACAGCCCATTTGCTGGGGGTGTATTTCTTG
TATCCATTCATTTCCCACCTGATTATCCATTCAAGCCACCGAAGGTGGCC
TTCCGTACTAAGGTTTTCCACCCTAACATCAACAGCAATGGTAGCATCTG
TCTTGACATTCTCAAGGAGCAGTGGAGCCCTGCTTTGACAATATCCAAGG
TACTTCTGTCAATTTGCTCACTACTTACTGATCCGAACCCAGATGACCCA
CTTGTGCCTGAGATTGCTCACATGTACAAGACTGACAGAGCCAAATATGA
GACTACTGCTCGATCCTGGACTCAGAAGTATGCCATGGGTTAAGAGGGGC
TAGGCTGTATGCCCCTGAGAACATTAATGGCTTGTGGTCCTATTAGTAAA
TAATAGAAATAAGTTTGTTTCAGATATTAAAAGACGATATTTGGTTTTGT
TTACTAAGTTGTTAAAAGGTTTTATGTGGGGTTACTTTCAAATTTAGCAT
TGTTCTTCAATACTTAAATTATAATTTACTGCAGAATTGAGCTGCCTTTG
CCT
back to top