DC900030

Overview
NameDC900030
Unique NameDC900030
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length703
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4784 contig Csv1_Contig4784:168..869. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC2_CANAL (Ubiquitin-conjugating enzyme E2 2 OS=Candida albicans GN=UBC2 PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.764e-32
Identity = 64/148 (43.24%), Postives = 94/148 (63.51%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY-----ETTARSW 469
            S  A +R+ ++ K +Q+DPP+  SA P+ D++  W A I+GPSD+PF  G F + + F   YP KPP+V F +++FHPN+ ++G +CLDIL+ +WSP   +S +L S+ SLL DPN   P   E A++YK  R+ Y     ET   SW
Sbjct:    2 STPARRRLMRDFKRMQQDPPSGVSASPLPDNVMKWNAVIIGPSDTPFEDGTFRLLLSFDEQYPNKPPQVKFISEMFHPNVYASGELCLDILQNRWSPTYDVSSILTSVQSLLNDPNISSPANVEAANLYKDHRSLYVKRVRETVENSW 149          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC2_NEUCR (Ubiquitin-conjugating enzyme E2 2 OS=Neurospora crassa GN=mus-8 PE=3 SV=3)

HSP 1 Score: 139.043 bits (349), Expect = 2.303e-32
Identity = 65/148 (43.92%), Postives = 93/148 (62.84%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY-----ETTARSW 469
            S  A +R+ ++ K +Q DPPA  SA PV D++  W A I+GP+D+PF  G F + +HF   YP KPP V F +++FHPN+ + G +CLDIL+ +WSP   ++ VL SI SLL DPN       E +++YK +R +Y     ET  +SW
Sbjct:    2 STAARRRLMRDFKRMQTDPPAGVSASPVPDNVMTWNAVIIGPADTPFEDGTFRLVMHFEEQYPNKPPSVKFISEMFHPNVYATGELCLDILQNRWSPTYDVAAVLTSIQSLLNDPNTGSRANVEASNLYKDNRKEYHKRVRETVEKSW 149          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC13_YEAST (Ubiquitin-conjugating enzyme E2 13 OS=Saccharomyces cerevisiae GN=UBC13 PE=1 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.303e-32
Identity = 67/143 (46.85%), Postives = 91/143 (63.64%), Query Frame = 2
Query:   56 KRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 484
            KRI KE + L  DP    +A P  D++ ++Q TI GP  SP+  G+F + ++ P DYP + PKV F TK++HPNI+  G ICLD+LK  WSPAL I  VLLSI +LL  PNP+DPL  ++A  +  +    +  AR WT+ YA
Sbjct:    6 KRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAREWTKLYA 148          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC2_YARLI (Ubiquitin-conjugating enzyme E2 2 OS=Yarrowia lipolytica GN=UBC2 PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 3.008e-32
Identity = 64/149 (42.95%), Postives = 93/149 (62.42%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE-----TTARSWT 472
            S  A +R+ ++ K +Q+DPP   SA PVAD++  W A I+GP+++PF  G F + + F   YP KPP V F +++FHPN+ S+G +CLDIL+ +WSP   ++ +L S+ SLL DPN   P   E + +YK  R +YE     T   SWT
Sbjct:    2 STTARRRLMRDFKRMQQDPPQGVSASPVADNVLTWNAVIIGPAETPFEDGTFRMVLQFDEQYPNKPPAVKFVSQMFHPNVYSSGELCLDILQNRWSPTYDVAAILTSVQSLLNDPNTSSPANVEASMLYKDHRQQYEKRVRDTVEASWT 150          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC2_DEBHA (Ubiquitin-conjugating enzyme E2 2 OS=Debaryomyces hansenii GN=UBC2 PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 5.131e-32
Identity = 63/150 (42.00%), Postives = 94/150 (62.67%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY-----ETTARSWTQ 475
            S  A +R+ ++ K +Q+D P+  SA P+ D++  W A I+GP+D+PF  G F + + F   YP KPP V F +++FHPN+ ++G +CLDIL+ +WSP   +S +L SI SLL DPN   P   E A++YK  R++Y     ET   SW +
Sbjct:    2 STPAKRRLMRDFKRMQQDAPSGVSASPLPDNVMSWNAVIIGPADTPFEDGTFRLILQFDEQYPNKPPSVKFISEMFHPNVYASGELCLDILQNRWSPTYDVSSILTSIQSLLNDPNISSPANVEAANLYKDHRSQYIKRVRETVENSWNE 151          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC1_CAEEL (Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditis elegans GN=ubc-1 PE=1 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 5.131e-32
Identity = 60/132 (45.45%), Postives = 89/132 (67.42%), Query Frame = 2
Query:   56 KRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 451
            +R+ ++ K LQ+DPPA  S  P  D++  W+A I GP ++PF  G F +S+ F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   ++ +L SI SLL +PNP+ P     A +Y+ +R +YE
Sbjct:    7 RRLMRDFKKLQEDPPAGVSGAPTEDNILTWEAIIFGPQETPFEDGTFKLSLEFTEEYPNKPPTVKFISKMFHPNVYADGSICLDILQNRWSPTYDVAAILTSIQSLLDEPNPNSPANSLAAQLYQENRREYE 138          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBE2A_MOUSE (Ubiquitin-conjugating enzyme E2 A OS=Mus musculus GN=Ube2a PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.493e-31
Identity = 61/137 (44.53%), Postives = 90/137 (65.69%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 451
            S  A +R+ ++ K LQ+DPPA  S  P  +++  W A I GP  +PF  G F ++I F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   +S +L SI SLL +PNP+ P   + A +Y+ ++ +YE
Sbjct:    2 STPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYE 138          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBE2A_HUMAN (Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens GN=UBE2A PE=2 SV=2)

HSP 1 Score: 136.346 bits (342), Expect = 1.493e-31
Identity = 61/137 (44.53%), Postives = 90/137 (65.69%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 451
            S  A +R+ ++ K LQ+DPPA  S  P  +++  W A I GP  +PF  G F ++I F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   +S +L SI SLL +PNP+ P   + A +Y+ ++ +YE
Sbjct:    2 STPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYE 138          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBE2B_RAT (Ubiquitin-conjugating enzyme E2 B OS=Rattus norvegicus GN=Ube2b PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.326e-31
Identity = 60/137 (43.80%), Postives = 88/137 (64.23%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 451
            S  A +R+ ++ K LQ+DPP   S  P  +++  W A I GP  +PF  G F + I F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   +S +L SI SLL +PNP+ P   + A +Y+ ++ +YE
Sbjct:    2 STPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYE 138          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBE2B_RABIT (Ubiquitin-conjugating enzyme E2 B OS=Oryctolagus cuniculus GN=UBE2B PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.326e-31
Identity = 60/137 (43.80%), Postives = 88/137 (64.23%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 451
            S  A +R+ ++ K LQ+DPP   S  P  +++  W A I GP  +PF  G F + I F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   +S +L SI SLL +PNP+ P   + A +Y+ ++ +YE
Sbjct:    2 STPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYE 138          
The following BLAST results are available for this feature:
BLAST of DC900030 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UBC2_CANAL1.764e-3243.24Ubiquitin-conjugating enzyme E2 2 OS=Candida albic... [more]
UBC2_NEUCR2.303e-3243.92Ubiquitin-conjugating enzyme E2 2 OS=Neurospora cr... [more]
UBC13_YEAST2.303e-3246.85Ubiquitin-conjugating enzyme E2 13 OS=Saccharomyce... [more]
UBC2_YARLI3.008e-3242.95Ubiquitin-conjugating enzyme E2 2 OS=Yarrowia lipo... [more]
UBC2_DEBHA5.131e-3242.00Ubiquitin-conjugating enzyme E2 2 OS=Debaryomyces ... [more]
UBC1_CAEEL5.131e-3245.45Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditi... [more]
UBE2A_MOUSE1.493e-3144.53Ubiquitin-conjugating enzyme E2 A OS=Mus musculus ... [more]
UBE2A_HUMAN1.493e-3144.53Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens ... [more]
UBE2B_RAT3.326e-3143.80Ubiquitin-conjugating enzyme E2 B OS=Rattus norveg... [more]
UBE2B_RABIT3.326e-3143.80Ubiquitin-conjugating enzyme E2 B OS=Oryctolagus c... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900030 VSS Citrus sinensis cDNA clone VS27Q38 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900030 ID=DC900030|Name=DC900030|organism=Citrus sinensis|type=EST|length=703bp
AGCCAGACCCAACTCTCAGGCCCCAAAGTTGTTGAGAAATTCCCAGATGG
CTTCAAAACGGATCAACAAGGAGTTGAAGGATCTACAGAAGGACCCTCCT
GCTTCTTGTAGCGCTGGCCCTGTTGCTGATGACATGTTCCATTGGCAAGC
AACAATTATGGGCCCATCAGACAGCCCATTTGCTGGGGGTGTATTTCTTG
TATCCATTCATTTCCCACCTGATTATCCATTCAAGCCACCGAAGGTGGCC
TTCCGTACTAAGGTTTTCCACCCTAACATCAACAGCAATGGTAGCATCTG
TCTTGACATTCTCAAGGAGCAGTGGAGCCCTGCTTTGACAATATCCAAGG
TACTTCTGTCAATTTGCTCACTACTTACTGATCCGAACCCAGATGACCCA
CTTGTGCCTGAGATTGCTCACATGTACAAGACTGACAGAGCCAAATATGA
GACTACTGCTCGATCCTGGACTCAGAAGTATGCCATGGGTTAAGAGGGGC
TAGGCTGTATGCCCCTGAGAACATTAATGGCTTGTGGTCCTATTAGTAAA
TAATAGAAATAAGTTTGTTTCAGATATTAAAAGACGATATTTGGTTTTGT
TTACTAAGTTGTTAAAAGGTTTTATGTGGGGTTACTTTCAAATTTAGCAT
TGTTCTTCAATACTTAAATTATAATTTACTGCAGAATTGAGCTGCCTTTG
CCT
back to top