DC900030

Overview
NameDC900030
Unique NameDC900030
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length703
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4784 contig Csv1_Contig4784:168..869. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC27_ARATH (Ubiquitin carrier protein E2 27 OS=Arabidopsis thaliana GN=UBC27 PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 3.677e-30
Identity = 66/144 (45.83%), Postives = 94/144 (65.28%), Query Frame = 2
Query:   59 RINKELKDLQKDPPAS-CSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 484
            RI KEL+D +++  +S     P +D++     TI GP  +P+ GG F + I  P  YPF+PPK+ F TKV+HPNI+S +G+ICLDILK+QWSPALT+   L+SI +LL+ P P DP    +A  Y  +   + +TAR WT+ +A
Sbjct:    6 RIQKELQDCERNQDSSGIRVCPKSDNLTRLTGTIPGPIGTPYEGGTFQIDITMPDGYPFEPPKMQFSTKVWHPNISSQSGAICLDILKDQWSPALTLKTALVSIQALLSAPEPKDPQDAVVAEQYMKNYQVFVSTARYWTETFA 149          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC2_KLULA (Ubiquitin-conjugating enzyme E2 2 OS=Kluyveromyces lactis GN=UBC2 PE=3 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 1.070e-29
Identity = 58/148 (39.19%), Postives = 93/148 (62.84%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY-----ETTARSW 469
            S  A +R+ ++ K +++D P   SA P+ D++  W A I+GP+D+P+  G F + + F  +YP KPP V F +++FHPN+ +NG ICLDIL+ +W+P   ++ +L SI SL  DPNP  P   E A +++  +++Y     ET  +SW
Sbjct:    2 STPARRRLMRDFKRMKEDSPPGVSASPLPDNVMIWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFQDHKSQYVKRVKETVEKSW 149          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UE2NL_HUMAN (Putative ubiquitin-conjugating enzyme E2 N-like OS=Homo sapiens GN=UBE2NL PE=5 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.635e-28
Identity = 66/144 (45.83%), Postives = 87/144 (60.42%), Query Frame = 2
Query:   59 RINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPS-DSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            RI KE + L  +P     A P   +  ++   I G S DSPF GG F   +    +YP   PKV F TK++HPN++    I LDILK++WSPAL I  VLLSI +LL  PNPDDPL  ++   +KT+ A+   TAR+WT+ YAM
Sbjct:    7 RIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGESKDSPFEGGTFKRELLLAEEYPMAAPKVRFMTKIYHPNVDKLERISLDILKDKWSPALQIRTVLLSIQALLNAPNPDDPLANDVVEQWKTNEAQAIETARAWTRLYAM 150          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBE2T_BOVIN (Ubiquitin-conjugating enzyme E2 T OS=Bos taurus GN=UBE2T PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 3.442e-28
Identity = 58/148 (39.19%), Postives = 92/148 (62.16%), Query Frame = 2
Query:   53 SKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL----KEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 484
            + R+ +EL  L  +PP   +     D M   +A I+G +++P+  GVF + +H P  YPF+PP++ F T ++HPNI+S G ICLD+L    K  W P+L I+ +L  I  L+ +PNPDDPL+ +I+  +K ++  +   AR WT+K+A
Sbjct:    4 TSRLKRELSLLAAEPPPGITCWQDGDRMEDLRAQILGGANTPYEKGVFKLEVHIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATLLTCIQQLMAEPNPDDPLMADISSEFKYNKPVFFKNARQWTEKHA 151          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC2_CRYNE (Ubiquitin-conjugating enzyme E2 2 OS=Cryptococcus neoformans GN=UBC2 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 4.495e-28
Identity = 60/148 (40.54%), Postives = 86/148 (58.11%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE-----TTARSW 469
            S  A +R+ ++ K L  D P   S  P  D++  W A I GP ++PF  G F +++ F   YP KPP V F +K+FHPNI +NG +CLDIL+ +WSP   ++ +L S+ SLL DPNP  P   + A ++K +  +YE     T   SW
Sbjct:    2 STAAKRRLIRDFKRLTSDAPIGISGSPNPDNIMVWNAVIFGPPETPFEDGSFRLTLTFTDAYPNKPPTVRFISKMFHPNIYANGELCLDILQNRWSPTYDVAAILTSVQSLLNDPNPASPANVDAAQLFKENLKEYERRVKKTVELSW 149          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBE2T_HUMAN (Ubiquitin-conjugating enzyme E2 T OS=Homo sapiens GN=UBE2T PE=1 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 5.871e-28
Identity = 59/148 (39.86%), Postives = 93/148 (62.84%), Query Frame = 2
Query:   53 SKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL----KEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 484
            + R+ +EL  L  +PP   +     D M   +A I+G +++P+  GVF + +  P  YPF+PP++ F T ++HPNI+S G ICLD+L    K  W P+L I+ VL SI  L+++PNPDDPL+ +I+  +K ++  +   AR WT+K+A
Sbjct:    4 ASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHA 151          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBE2C_DICDI (Probable ubiquitin-conjugating enzyme E2 C OS=Dictyostelium discoideum GN=ube2c PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 7.667e-28
Identity = 61/145 (42.07%), Postives = 87/145 (60.00%), Query Frame = 2
Query:   53 SKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKT--------DRAKYETTAR 463
            SKR+  EL +L   P    SA P  D++F+W  TI G  D+ +    F +S+ FP DYP+KPP V F T+ FHPN+++NG+ICLDILK++WSP   +  +L+SI SLL +PN + PL    A ++          D+   E T+R
Sbjct:    8 SKRLQSELMNLMMGPSPGISAFPDGDNIFNWIGTIQGAKDTVYEQMEFKMSLKFPTDYPYKPPTVKFETQCFHPNVDNNGNICLDILKDKWSPVYNVRSLLISIQSLLGEPNNESPLNSYAASLWSNQDEYKKVLDKRYQEATSR 152          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC37_ARATH (Probable ubiquitin carrier protein E2 37 OS=Arabidopsis thaliana GN=UBC37 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 2.231e-27
Identity = 69/157 (43.95%), Postives = 94/157 (59.87%), Query Frame = 2
Query:   53 SKRINKELKDLQKDPPASCS------AGPVADDMFHWQ---ATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL----KEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 484
            S R+ KELK L  DPP   S      A   + D   +    A I GP D+ +A G+F + I  P  YPF+PP V+F T ++HPNI+++G ICLDIL    K  W P+L IS VL S+  LL++PNPDD L+ E++  YK +R  ++  AR  T+KYA
Sbjct:    8 SLRMQKELKLLLSDPPHGASFPHLSSAANGSGDFSTFSTIDAQIEGPEDTVYANGIFNLKIQIPERYPFQPPIVSFATPIYHPNIDNSGRICLDILNLPPKGAWQPSLNISTVLTSMRLLLSEPNPDDGLMCEVSREYKYNRQTFDYKAREMTEKYA 164          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBE2T_MOUSE (Ubiquitin-conjugating enzyme E2 T OS=Mus musculus GN=Ube2t PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 2.914e-27
Identity = 59/148 (39.86%), Postives = 92/148 (62.16%), Query Frame = 2
Query:   53 SKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL----KEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 484
            + R+ KEL  L  +PP   +     D +   +A I+G +++P+  GVF + +  P  YPF+PP+V F T ++HPNI+S+G ICLDIL    K  W P+L I+ VL SI  L+ +PNPDDPL+ +I+  +K ++  +   A+ WT+ +A
Sbjct:    4 ASRLKKELHMLAIEPPPGITCWQEKDQVADLRAQILGGANTPYEKGVFTLEVIIPERYPFEPPQVRFLTPIYHPNIDSSGRICLDILKLPPKGAWRPSLNIATVLTSIQLLMAEPNPDDPLMADISSEFKYNKIAFLKKAKQWTEAHA 151          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBE2K_MOUSE (Ubiquitin-conjugating enzyme E2 K OS=Mus musculus GN=Ube2k PE=2 SV=3)

HSP 1 Score: 122.094 bits (305), Expect = 2.914e-27
Identity = 63/152 (41.45%), Postives = 91/152 (59.87%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPAS---CSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 484
            + +A +RI +E K++ K    S        V ++    +  I GP D+P+ GG + + I  P  YPF PPKV F TK++HPNI+S  G+ICLDILK+QW+ A+T+  VLLS+ +LL    PDDP    +A+ YK +   ++ TAR W   YA
Sbjct:    2 ANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYA 153          
The following BLAST results are available for this feature:
BLAST of DC900030 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UBC27_ARATH3.677e-3045.83Ubiquitin carrier protein E2 27 OS=Arabidopsis tha... [more]
UBC2_KLULA1.070e-2939.19Ubiquitin-conjugating enzyme E2 2 OS=Kluyveromyces... [more]
UE2NL_HUMAN2.635e-2845.83Putative ubiquitin-conjugating enzyme E2 N-like OS... [more]
UBE2T_BOVIN3.442e-2839.19Ubiquitin-conjugating enzyme E2 T OS=Bos taurus GN... [more]
UBC2_CRYNE4.495e-2840.54Ubiquitin-conjugating enzyme E2 2 OS=Cryptococcus ... [more]
UBE2T_HUMAN5.871e-2839.86Ubiquitin-conjugating enzyme E2 T OS=Homo sapiens ... [more]
UBE2C_DICDI7.667e-2842.07Probable ubiquitin-conjugating enzyme E2 C OS=Dict... [more]
UBC37_ARATH2.231e-2743.95Probable ubiquitin carrier protein E2 37 OS=Arabid... [more]
UBE2T_MOUSE2.914e-2739.86Ubiquitin-conjugating enzyme E2 T OS=Mus musculus ... [more]
UBE2K_MOUSE2.914e-2741.45Ubiquitin-conjugating enzyme E2 K OS=Mus musculus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900030 VSS Citrus sinensis cDNA clone VS27Q38 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900030 ID=DC900030|Name=DC900030|organism=Citrus sinensis|type=EST|length=703bp
AGCCAGACCCAACTCTCAGGCCCCAAAGTTGTTGAGAAATTCCCAGATGG
CTTCAAAACGGATCAACAAGGAGTTGAAGGATCTACAGAAGGACCCTCCT
GCTTCTTGTAGCGCTGGCCCTGTTGCTGATGACATGTTCCATTGGCAAGC
AACAATTATGGGCCCATCAGACAGCCCATTTGCTGGGGGTGTATTTCTTG
TATCCATTCATTTCCCACCTGATTATCCATTCAAGCCACCGAAGGTGGCC
TTCCGTACTAAGGTTTTCCACCCTAACATCAACAGCAATGGTAGCATCTG
TCTTGACATTCTCAAGGAGCAGTGGAGCCCTGCTTTGACAATATCCAAGG
TACTTCTGTCAATTTGCTCACTACTTACTGATCCGAACCCAGATGACCCA
CTTGTGCCTGAGATTGCTCACATGTACAAGACTGACAGAGCCAAATATGA
GACTACTGCTCGATCCTGGACTCAGAAGTATGCCATGGGTTAAGAGGGGC
TAGGCTGTATGCCCCTGAGAACATTAATGGCTTGTGGTCCTATTAGTAAA
TAATAGAAATAAGTTTGTTTCAGATATTAAAAGACGATATTTGGTTTTGT
TTACTAAGTTGTTAAAAGGTTTTATGTGGGGTTACTTTCAAATTTAGCAT
TGTTCTTCAATACTTAAATTATAATTTACTGCAGAATTGAGCTGCCTTTG
CCT
back to top