DC900028

Overview
NameDC900028
Unique NameDC900028
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length712
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4378 contig Csv1_Contig4378:57..772. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900028 vs. ExPASy Swiss-Prot
Match: HMGB1_RAT (High mobility group protein B1 OS=Rattus norvegicus GN=Hmgb1 PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 1.578e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  189 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRR 416
            DPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 165          
BLAST of DC900028 vs. ExPASy Swiss-Prot
Match: HMGB1_PAPAN (High mobility group protein B1 OS=Papio anubis GN=HMGB1 PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.578e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  189 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRR 416
            DPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 165          
BLAST of DC900028 vs. ExPASy Swiss-Prot
Match: HMGB1_MOUSE (High mobility group protein B1 OS=Mus musculus GN=Hmgb1 PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 1.578e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  189 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRR 416
            DPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 165          
BLAST of DC900028 vs. ExPASy Swiss-Prot
Match: HMGB1_MACFA (High mobility group protein B1 OS=Macaca fascicularis GN=HMGB1 PE=2 SV=3)

HSP 1 Score: 73.1738 bits (178), Expect = 1.578e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  189 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRR 416
            DPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 165          
BLAST of DC900028 vs. ExPASy Swiss-Prot
Match: HMGB1_HUMAN (High mobility group protein B1 OS=Homo sapiens GN=HMGB1 PE=1 SV=3)

HSP 1 Score: 73.1738 bits (178), Expect = 1.578e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  189 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRR 416
            DPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 165          
BLAST of DC900028 vs. ExPASy Swiss-Prot
Match: HMGB1_HORSE (High mobility group protein B1 OS=Equus caballus GN=HMGB1 PE=2 SV=3)

HSP 1 Score: 73.1738 bits (178), Expect = 1.578e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  189 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRR 416
            DPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 165          
BLAST of DC900028 vs. ExPASy Swiss-Prot
Match: HMGB1_CRIGR (High mobility group protein B1 (Fragment) OS=Cricetulus griseus GN=HMGB1 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.578e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  189 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRR 416
            DPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   56 DPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 130          
BLAST of DC900028 vs. ExPASy Swiss-Prot
Match: HMGB1_CANFA (High mobility group protein B1 OS=Canis familiaris GN=HMGB1 PE=2 SV=3)

HSP 1 Score: 73.1738 bits (178), Expect = 1.578e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  189 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRR 416
            DPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 165          
BLAST of DC900028 vs. ExPASy Swiss-Prot
Match: HMGB1_CALMO (High mobility group protein B1 OS=Callicebus moloch GN=HMGB1 PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.578e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  189 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRR 416
            DPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 165          
BLAST of DC900028 vs. ExPASy Swiss-Prot
Match: HMGB1_CALJA (High mobility group protein B1 OS=Callithrix jacchus GN=HMGB1 PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.578e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  189 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRR 416
            DPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 165          
The following BLAST results are available for this feature:
BLAST of DC900028 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 38
Match NameE-valueIdentityDescription
HMGB1_RAT1.578e-1247.37High mobility group protein B1 OS=Rattus norvegicu... [more]
HMGB1_PAPAN1.578e-1247.37High mobility group protein B1 OS=Papio anubis GN=... [more]
HMGB1_MOUSE1.578e-1247.37High mobility group protein B1 OS=Mus musculus GN=... [more]
HMGB1_MACFA1.578e-1247.37High mobility group protein B1 OS=Macaca fascicula... [more]
HMGB1_HUMAN1.578e-1247.37High mobility group protein B1 OS=Homo sapiens GN=... [more]
HMGB1_HORSE1.578e-1247.37High mobility group protein B1 OS=Equus caballus G... [more]
HMGB1_CRIGR1.578e-1247.37High mobility group protein B1 (Fragment) OS=Crice... [more]
HMGB1_CANFA1.578e-1247.37High mobility group protein B1 OS=Canis familiaris... [more]
HMGB1_CALMO1.578e-1247.37High mobility group protein B1 OS=Callicebus moloc... [more]
HMGB1_CALJA1.578e-1247.37High mobility group protein B1 OS=Callithrix jacch... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900028 VSS Citrus sinensis cDNA clone VS27Q36 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900028 ID=DC900028|Name=DC900028|organism=Citrus sinensis|type=EST|length=712bp
TCTGCGTCTCTCTCTTTTTCTCTTTCCTCTTTTTCTCTCATTTGAAGCCC
TAACCCTAGCTCTATCTTTCTTCAGAAACAGGATTTGAAATGAAAGGAGG
TAAATCAAAGTCAGATACCAGAAACGCCAAGCTCTCTGTGAACAAGAAGC
CTGCCAAAGCTGGACGAAAATCGGGAAAGGCAGCTAAGGACCCGAACAAG
CCAAAGAGGCCAGCCAGCGCCTTCTTTGTTTTCATGGAAGAATTCCGTGA
ACAATACAAGAAGGATCATCCTAAGAACAAATCAGTTGCTGCTGTTGGTA
AAGCTGGTGGTGAGAAATGGAAGTCAATGTCTGAAGCTGATAAAGCACCG
TATGTTGCTAAGGCAGAGAAGCGCAAGGTTGAGTATGAGAAGGATATGAA
AAACTACAATAGGAGACAGGCGGAGGGAACTAAGCCGGAGGAAGAAGAGG
AGTCTGAGAAGTCTATGTCAGAGGTGAATGATGAGGATGATGATGAAGAA
GGCAGTGGCGAGGAGGATGATGATGAATAGAAGTTGAAGGAAGAAATTAG
CATAGTCATGTTAGGCTGTGACAATGTTTCAAACAACATATGTTAATGCT
TGNGCTTCCATGTTAATTTTTTGGATGCTTTCATCATCTTCATCATCATG
TAGAGATCATGTTGCTTCTNCCTCGACATTTTCTTATGCCTGCCTTTCAA
GAATAATAGCTG
back to top