DC900025

Overview
NameDC900025
Unique NameDC900025
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length592
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9720 contig Csv1_Contig9720:77..668. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: FEI1_ARATH (LRR receptor-like serine/threonine-protein kinase FEI 1 OS=Arabidopsis thaliana GN=FEI1 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.478e-12
Identity = 39/100 (39.00%), Postives = 55/100 (55.00%), Query Frame = 2
Query:  293 GHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            G   P       +  L +  N L G+IP  +G+ + L  ++L  N  +GPIP E+GDL GL  LD+SSN L G IP+S+  L  L+  ++  N L G IP
Sbjct:   88 GPLPPDIGKLDHLRLLMLHNNALYGAIPTALGNCTALEEIHLQSNYFTGPIPAEMGDLPGLQKLDMSSNTLSGPIPASLGQLKKLSNFNVSNNFLVGQIP 187          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: SERK5_ARATH (Somatic embryogenesis receptor kinase 5 OS=Arabidopsis thaliana GN=SERK5 PE=1 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 3.237e-12
Identity = 38/100 (38.00%), Postives = 61/100 (61.00%), Query Frame = 2
Query:  293 GHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            G   P      ++ +L++  N ++G IP+E+G +  L  L+L  NN+SGPIP+ +G L  L  L L +N L G IP S+++L  L+ +D+  N+L+G IP
Sbjct:   84 GELVPQLAQLPNLQYLELFNNNITGEIPEELGDLMELVSLDLFANNISGPIPSSLGKLGKLRFLRLYNNSLSGEIPRSLTALP-LDVLDISNNRLSGDIP 182          

HSP 2 Score: 67.0106 bits (162), Expect = 7.972e-11
Identity = 41/110 (37.27%), Postives = 59/110 (53.64%), Query Frame = 2
Query:  263 SPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +PC++  V       T N   S+  LD+    LSG +  ++  +  L  L L +NN++G IP E+GDL  L  LDL +N + G IPSS+  L  L  + L  N L+G IP
Sbjct:   57 TPCSWFHV-------TCNTENSVTRLDLGSANLSGELVPQLAQLPNLQYLELFNNNITGEIPEELGDLMELVSLDLFANNISGPIPSSLGKLGKLRFLRLYNNSLSGEIP 159          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y4372_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g37250 OS=Arabidopsis thaliana GN=At4g37250 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 5.521e-12
Identity = 38/110 (34.55%), Postives = 63/110 (57.27%), Query Frame = 2
Query:  263 SPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            SPC++  +       + N++  ++ L +  + L GSIP ++GS+  L  L+L +N+ +GP+P    + R L  LDLSSN + G IPS++  L  L  ++L  N L G +P
Sbjct:   53 SPCSWRGI-------SCNNDSKVLTLSLPNSQLLGSIPSDLGSLLTLQSLDLSNNSFNGPLPVSFFNARELRFLDLSSNMISGEIPSAIGDLHNLLTLNLSDNALAGKLP 155          

HSP 2 Score: 70.4774 bits (171), Expect = 7.210e-12
Identity = 37/102 (36.27%), Postives = 54/102 (52.94%), Query Frame = 2
Query:  287 YGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            + G    +F +   + FLD+S NM+SG IP  IG +  L  LNL  N L+G +PT +  LR L ++ L +N   G IP     +  L   DL +N + G +P
Sbjct:  102 FNGPLPVSFFNARELRFLDLSSNMISGEIPSAIGDLHNLLTLNLSDNALAGKLPTNLASLRNLTVVSLENNYFSGEIPGGWRVVEFL---DLSSNLINGSLP 200          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y5720_ARATH (Probable inactive receptor kinase At5g67200 OS=Arabidopsis thaliana GN=At5g67200 PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 7.210e-12
Identity = 58/185 (31.35%), Postives = 85/185 (45.95%), Query Frame = 2
Query:   77 NLFNGSIPP-ALFKQSGKIAAN------FIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQ------PTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N FN  +P  A+   S K  A+      + + ++Y Y +  G K   G    L  +G+        +T S  +  RV            P  +H  ++  L +S N  SG+ P  I S+  L IL++ HNN SG IP+E+  L  L  L+L  NR  GT+PS   S   L   ++  N LTG+IP
Sbjct:   25 NYFNSLLPSDAVALLSFKSTADLDNKLLYSLTERYDYCQWRGVKCAQGRIVRLVLSGVGLRGYFSSATLSRLDQLRVLSLENNSLFGPIPDLSHLVNLKSLFLSRNQFSGAFPPSILSLHRLMILSISHNNFSGSIPSEINALDRLTSLNLDFNRFNGTLPSLNQS--FLTSFNVSGNNLTGVIP 207          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: PGIP2_ARATH (Polygalacturonase inhibitor 2 OS=Arabidopsis thaliana GN=PGIP2 PE=2 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 7.210e-12
Identity = 38/101 (37.62%), Postives = 59/101 (58.42%), Query Frame = 2
Query:  293 GHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLT-LLNEIDLGTNQLTGMIP 592
            GH QPT     ++ FL +S+  L+G +P+ +  +  L  ++L  N+LSG IP+ +  LR L  L+LS N+L G IP S  + +  +  + L  NQL+G IP
Sbjct:  109 GHIQPTIAKLKNLTFLRLSWTNLTGPVPEFLSQLKNLEYIDLSFNDLSGSIPSSLSSLRKLEYLELSRNKLTGPIPESFGTFSGKVPSLFLSHNQLSGTIP 209          

HSP 2 Score: 67.0106 bits (162), Expect = 7.972e-11
Identity = 35/78 (44.87%), Postives = 47/78 (60.26%), Query Frame = 2
Query:  359 LSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            L+G I   I  +  L  L L   NL+GP+P  +  L+ L  +DLS N L G+IPSS+SSL  L  ++L  N+LTG IP
Sbjct:  107 LTGHIQPTIAKLKNLTFLRLSWTNLTGPVPEFLSQLKNLEYIDLSFNDLSGSIPSSLSSLRKLEYLELSRNKLTGPIP 184          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y1684_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g06840 OS=Arabidopsis thaliana GN=At1g06840 PE=1 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 1.230e-11
Identity = 34/106 (32.08%), Postives = 56/106 (52.83%), Query Frame = 2
Query:  275 FTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            F+    G+  P       +  L   +N ++GSIPKEIG++  L +L L  N L+G +P E+G L  L+ + +  NR+ G +P S ++L       +  N ++G IP
Sbjct:   91 FSMNLSGNLSPELGRLSRLTILSFMWNKITGSIPKEIGNIKSLELLLLNGNLLNGNLPEELGFLPNLDRIQIDENRISGPLPKSFANLNKTKHFHMNNNSISGQIP 196          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y5129_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g10290 OS=Arabidopsis thaliana GN=At5g10290 PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.606e-11
Identity = 35/85 (41.18%), Postives = 55/85 (64.71%), Query Frame = 2
Query:  338 LDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            L +  N ++G IP++ G+++ L  L+L  N L+G IP+ +G+L+ L  L LS N+L GTIP S++ L  L  + L +N L+G IP
Sbjct:   99 LTLKGNGITGEIPEDFGNLTSLTSLDLEDNQLTGRIPSTIGNLKKLQFLTLSRNKLNGTIPESLTGLPNLLNLLLDSNSLSGQIP 183          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y1534_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53420 OS=Arabidopsis thaliana GN=At1g53420 PE=2 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 1.606e-11
Identity = 36/80 (45.00%), Postives = 50/80 (62.50%), Query Frame = 2
Query:  353 NMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N L+G IPKE G+++ L  L L  N LSG +P E+G+L  +  + LSSN   G IPS+ + LT L +  +  NQL+G IP
Sbjct:  120 NRLTGPIPKEFGNITTLTSLVLEANQLSGELPLELGNLPNIQQMILSSNNFNGEIPSTFAKLTTLRDFRVSDNQLSGTIP 199          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: RKF1_ARATH (Probable LRR receptor-like serine/threonine-protein kinase RFK1 OS=Arabidopsis thaliana GN=RKF1 PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.606e-11
Identity = 42/102 (41.18%), Postives = 60/102 (58.82%), Query Frame = 2
Query:  287 YGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            Y   T P    + ++ F+ +  N LSG IPKE G+ S L  L+L  N  SG IP E+G+L  L  L LSSN+L GT+P+S++ L  + +  +   QL+G IP
Sbjct:  134 YINGTLPREWASSNLTFISLLVNRLSGEIPKEFGNSS-LTYLDLESNAFSGTIPQELGNLVHLKKLLLSSNKLTGTLPASLARLQNMTDFRINDLQLSGTIP 234          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y4374_ARATH (Probable inactive receptor kinase At4g23740 OS=Arabidopsis thaliana GN=At4g23740 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.098e-11
Identity = 35/95 (36.84%), Postives = 54/95 (56.84%), Query Frame = 2
Query:  308 TFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            T +   ++  L +  N++SG  PK+   +  L  L L  NNLSGP+P +    + L  ++LS+N   GTIPSS+S L  +  ++L  N L+G IP
Sbjct:   88 TISRLSALRVLSLRSNLISGEFPKDFVELKDLAFLYLQDNNLSGPLPLDFSVWKNLTSVNLSNNGFNGTIPSSLSRLKRIQSLNLANNTLSGDIP 182          
The following BLAST results are available for this feature:
BLAST of DC900025 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
FEI1_ARATH2.478e-1239.00LRR receptor-like serine/threonine-protein kinase ... [more]
SERK5_ARATH3.237e-1238.00Somatic embryogenesis receptor kinase 5 OS=Arabido... [more]
Y4372_ARATH5.521e-1234.55Probable LRR receptor-like serine/threonine-protei... [more]
Y5720_ARATH7.210e-1231.35Probable inactive receptor kinase At5g67200 OS=Ara... [more]
PGIP2_ARATH7.210e-1237.62Polygalacturonase inhibitor 2 OS=Arabidopsis thali... [more]
Y1684_ARATH1.230e-1132.08Probable LRR receptor-like serine/threonine-protei... [more]
Y5129_ARATH1.606e-1141.18Probable LRR receptor-like serine/threonine-protei... [more]
Y1534_ARATH1.606e-1145.00Probable LRR receptor-like serine/threonine-protei... [more]
RKF1_ARATH1.606e-1141.18Probable LRR receptor-like serine/threonine-protei... [more]
Y4374_ARATH2.098e-1136.84Probable inactive receptor kinase At4g23740 OS=Ara... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900025 VSS Citrus sinensis cDNA clone VS27Q33 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900025 ID=DC900025|Name=DC900025|organism=Citrus sinensis|type=EST|length=592bp
CAACAACTCCTTTTATGGTAGGATCCCTCCGGAGCTTGGAGATTGTCGAA
GCTTGATATGGTTGGATCTTAATACCAACTTATTTAATGGATCCATCCCT
CCTGCATTGTTCAAGCAATCTGGTAAAATTGCGGCTAACTTTATTGTGGG
GAAGAAGTATGTGTATATCAAGAATGATGGTAGCAAAGAGTGTCATGGAG
CTGGAAACTTGCTCGAGTTTGCAGGAATTAGAGCTGAGCGGTTGAGCAGA
ATTTCCACCAGGAGCCCCTGCAACTTCACTAGAGTATATGGAGGTCACAC
TCAGCCTACATTTAACCATAATGGATCGATGATGTTTCTTGATATTTCGT
ACAACATGCTGTCGGGTAGCATTCCGAAGGAGATTGGTTCTATGTCATAT
CTTTTCATCTTGAATTTGGGCCATAACAATCTCTCCGGTCCTATTCCAAC
AGAGGTGGGAGACTTACGAGGTCTTAACATTCTTGACCTCTCGAGCAACA
GGCTTGAAGGGACAATTCCATCATCCATGAGTTCTCTTACGTTGCTTAAT
GAGATTGATCTGGGCACCAACCAACTCACTGGTATGATTCCT
back to top