DC900025

Overview
NameDC900025
Unique NameDC900025
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length592
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9720 contig Csv1_Contig9720:77..668. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: PGIP3_PHAVU (Polygalacturonase inhibitor 3 OS=Phaseolus vulgaris GN=PGIP3 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.098e-11
Identity = 55/192 (28.65%), Postives = 93/192 (48.44%), Query Frame = 2
Query:   17 GRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            G IP  L   ++L+ LD + N  +G++PP++      +   F           DG++    +G + +  G      S++ T    +  R+ G    PTF  N ++ F+D+S NML G      GS      ++L  N+L   +  +VG  + LN LDL +NR+ GT+P  ++ L  L+ +++  N L G IP
Sbjct:  144 GAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITF-----------DGNRI---SGAIPDSYG----SFSKLFTSMTISRNRLTG-KIPPTFA-NLNLAFVDLSRNMLQGDASVLFGSDKNTQKIHLAKNSLDFDLE-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP 314          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: PGIP2_PHAVU (Polygalacturonase inhibitor 2 OS=Phaseolus vulgaris GN=PGIP2 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.098e-11
Identity = 55/192 (28.65%), Postives = 94/192 (48.96%), Query Frame = 2
Query:   17 GRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            G IP  L   ++L+ LD + N  +G++PP++      +   F           DG++    +G + +  G      S++ T    +  R+ G    PTF  N ++ F+D+S NML G      GS      ++L  N+L+  +  +VG  + LN LDL +NR+ GT+P  ++ L  L+ +++  N L G IP
Sbjct:  144 GAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITF-----------DGNRI---SGAIPDSYG----SFSKLFTSMTISRNRLTG-KIPPTFA-NLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP 314          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: PGIP1_ORYSJ (Polygalacturonase inhibitor 1 OS=Oryza sativa subsp. japonica GN=FOR1 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.098e-11
Identity = 36/78 (46.15%), Postives = 49/78 (62.82%), Query Frame = 2
Query:  359 LSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            LSG IP  + ++S L  L + H N+SG IP  +  +R L+ +DLS N L G IP+S S L  L  +DL +N+LTG IP
Sbjct:  108 LSGPIPACLTALSNLQFLTISHTNVSGVIPDSLARIRSLDSVDLSHNSLTGPIPNSFSDLPNLRSLDLRSNKLTGCIP 185          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: SERK4_ARATH (Somatic embryogenesis receptor kinase 4 OS=Arabidopsis thaliana GN=SERK4 PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 2.740e-11
Identity = 36/100 (36.00%), Postives = 61/100 (61.00%), Query Frame = 2
Query:  293 GHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            G   P      ++ +L++  N ++G IP+E+G +  L  L+L  N++SGPIP+ +G L  L  L L++N L G IP +++S+  L  +D+  N+L+G IP
Sbjct:   89 GKLVPELGQLLNLQYLELYSNNITGEIPEELGDLVELVSLDLYANSISGPIPSSLGKLGKLRFLRLNNNSLSGEIPMTLTSVQ-LQVLDISNNRLSGDIP 187          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: SERK2_ARATH (Somatic embryogenesis receptor kinase 2 OS=Arabidopsis thaliana GN=SERK2 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.740e-11
Identity = 39/110 (35.45%), Postives = 59/110 (53.64%), Query Frame = 2
Query:  263 SPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +PC +  V       T N+  S++ +D+    LSG +  ++G +  L  L L  NN++GP+P+++G+L  L  LDL  N   G IP S+  L  L  + L  N LTG IP
Sbjct:   59 NPCTWFHV-------TCNNENSVIRVDLGNADLSGQLVPQLGQLKNLQYLELYSNNITGPVPSDLGNLTNLVSLDLYLNSFTGPIPDSLGKLFKLRFLRLNNNSLTGPIP 161          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y5830_ARATH (Probable inactive receptor kinase At5g58300 OS=Arabidopsis thaliana GN=At5g58300 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.578e-11
Identity = 37/89 (41.57%), Postives = 54/89 (60.67%), Query Frame = 2
Query:  326 SMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            S+  L +  N+LSG++P +I S+  L  + L HNN SG +P+ V   R LNILDLS N   G IP++  +L  L  + L  N+L+G +P
Sbjct:  113 SLRILSLRSNLLSGNLPPDIHSLPSLDYIYLQHNNFSGEVPSFVS--RQLNILDLSFNSFTGKIPATFQNLKQLTGLSLQNNKLSGPVP 199          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y5343_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53430 OS=Arabidopsis thaliana GN=At1g53430 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.578e-11
Identity = 53/184 (28.80%), Postives = 85/184 (46.20%), Query Frame = 2
Query:    8 SFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNF-TRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEI 556
            S  G  PPE G+   L  +DL+ N  NG+IP  L +   +I +  ++G +                     +G    +L  I+T +  N  T ++ G       +  S+  L +S N  +G IP+ + ++  L    +  N+LSG IP  +G+   L  LDL    +EG IP S+S+LT L E+
Sbjct:  101 SLPGIFPPEFGNLTRLREIDLSRNFLNGTIPTTLSQIPLEILS--VIGNR--------------------LSGPFPPQLGDITTLTDVNLETNLFTGPLPRNLGNLRSLKELLLSANNFTGQIPESLSNLKNLTEFRIDGNSLSGKIPDFIGNWTLLERLDLQGTSMEGPIPPSISNLTNLTEL 262          

HSP 2 Score: 68.1662 bits (165), Expect = 3.578e-11
Identity = 41/123 (33.33%), Postives = 62/123 (50.41%), Query Frame = 2
Query:  224 GIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            GI       ++     + +R +   T PT      +  L +  N LSG  P ++G ++ L  +NL  N  +GP+P  +G+LR L  L LS+N   G IP S+S+L  L E  +  N L+G IP
Sbjct:  104 GIFPPEFGNLTRLREIDLSRNFLNGTIPTTLSQIPLEILSVIGNRLSGPFPPQLGDITTLTDVNLETNLFTGPLPRNLGNLRSLKELLLSANNFTGQIPESLSNLKNLTEFRIDGNSLSGKIP 226          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y1561_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g56130 OS=Arabidopsis thaliana GN=At1g56130 PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 3.578e-11
Identity = 32/85 (37.65%), Postives = 54/85 (63.53%), Query Frame = 2
Query:  338 LDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            L++  N+L+GS+P  IG+++ +  +  G N LSGP+P E+G L  L +L +SSN   G+IP  +   T L ++ + ++ L+G IP
Sbjct:  128 LNLGQNVLTGSLPPAIGNLTRMQWMTFGINALSGPVPKEIGLLTDLRLLGISSNNFSGSIPDEIGRCTKLQQMYIDSSGLSGRIP 212          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y5614_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g56140 OS=Arabidopsis thaliana GN=At1g56140 PE=1 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 4.674e-11
Identity = 32/85 (37.65%), Postives = 54/85 (63.53%), Query Frame = 2
Query:  338 LDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            L++  N+L+GS+P  +G+++ +  +  G N LSGPIP E+G L  L +L +SSN   G+IP  +   T L +I + ++ L+G +P
Sbjct:  127 LNLGQNVLTGSLPPALGNLTRMRWMTFGINALSGPIPKEIGLLTDLRLLSISSNNFSGSIPDEIGRCTKLQQIYIDSSGLSGGLP 211          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: SRF3_ARATH (Protein STRUBBELIG-RECEPTOR FAMILY 3 OS=Arabidopsis thaliana GN=SRF3 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 4.674e-11
Identity = 34/82 (41.46%), Postives = 53/82 (64.63%), Query Frame = 2
Query:  344 ISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMI 589
            +S N  +GSIP+ +G++S+L  ++L  N LSG +P    +L GL  LD+SSN + GT+P SM +L  L  + +  NQL+G +
Sbjct:  127 LSANQFTGSIPESLGTLSFLNDMSLNDNLLSGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTL 208          
The following BLAST results are available for this feature:
BLAST of DC900025 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
PGIP3_PHAVU2.098e-1128.65Polygalacturonase inhibitor 3 OS=Phaseolus vulgari... [more]
PGIP2_PHAVU2.098e-1128.65Polygalacturonase inhibitor 2 OS=Phaseolus vulgari... [more]
PGIP1_ORYSJ2.098e-1146.15Polygalacturonase inhibitor 1 OS=Oryza sativa subs... [more]
SERK4_ARATH2.740e-1136.00Somatic embryogenesis receptor kinase 4 OS=Arabido... [more]
SERK2_ARATH2.740e-1135.45Somatic embryogenesis receptor kinase 2 OS=Arabido... [more]
Y5830_ARATH3.578e-1141.57Probable inactive receptor kinase At5g58300 OS=Ara... [more]
Y5343_ARATH3.578e-1128.80Probable LRR receptor-like serine/threonine-protei... [more]
Y1561_ARATH3.578e-1137.65Probable LRR receptor-like serine/threonine-protei... [more]
Y5614_ARATH4.674e-1137.65Probable LRR receptor-like serine/threonine-protei... [more]
SRF3_ARATH4.674e-1141.46Protein STRUBBELIG-RECEPTOR FAMILY 3 OS=Arabidopsi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900025 VSS Citrus sinensis cDNA clone VS27Q33 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900025 ID=DC900025|Name=DC900025|organism=Citrus sinensis|type=EST|length=592bp
CAACAACTCCTTTTATGGTAGGATCCCTCCGGAGCTTGGAGATTGTCGAA
GCTTGATATGGTTGGATCTTAATACCAACTTATTTAATGGATCCATCCCT
CCTGCATTGTTCAAGCAATCTGGTAAAATTGCGGCTAACTTTATTGTGGG
GAAGAAGTATGTGTATATCAAGAATGATGGTAGCAAAGAGTGTCATGGAG
CTGGAAACTTGCTCGAGTTTGCAGGAATTAGAGCTGAGCGGTTGAGCAGA
ATTTCCACCAGGAGCCCCTGCAACTTCACTAGAGTATATGGAGGTCACAC
TCAGCCTACATTTAACCATAATGGATCGATGATGTTTCTTGATATTTCGT
ACAACATGCTGTCGGGTAGCATTCCGAAGGAGATTGGTTCTATGTCATAT
CTTTTCATCTTGAATTTGGGCCATAACAATCTCTCCGGTCCTATTCCAAC
AGAGGTGGGAGACTTACGAGGTCTTAACATTCTTGACCTCTCGAGCAACA
GGCTTGAAGGGACAATTCCATCATCCATGAGTTCTCTTACGTTGCTTAAT
GAGATTGATCTGGGCACCAACCAACTCACTGGTATGATTCCT
back to top