DC900015

Overview
NameDC900015
Unique NameDC900015
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length557
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10926 contig Csv1_Contig10926:991..1547. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUPE (Non-specific lipid-transfer protein 1 OS=Prunus persica PE=1 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 4.206e-32
Identity = 60/91 (65.93%), Postives = 73/91 (80.22%), Query Frame = 1
Query:   64 ITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            ITCGQVS +LAPCI ++R GG +P  CCNG+R++N  ARTTPDRQ ACNCLKQ + S+P +N NNAA LPG CGV IPYKIS ST+C+ V+
Sbjct:    1 ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVHIPYKISASTNCATVK 91          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP4_LENCU (Non-specific lipid-transfer protein 4 (Fragment) OS=Lens culinaris PE=1 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 5.493e-32
Identity = 66/106 (62.26%), Postives = 81/106 (76.42%), Query Frame = 1
Query:   22 VLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMP-CCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            V+CM+V  P++  AI+CG V+  L+PC+ +L +GGP P P CC GV+ L AAA TTPDRQ ACNCLK AA SI  LN NNAA LPG CGV+IPYKISTST+C+ V+
Sbjct:    5 VMCMVVIAPMAEGAISCGAVTSDLSPCLTYL-TGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTSTNCNTVK 109          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP3_BRANA (Non-specific lipid-transfer protein 3 OS=Brassica napus GN=LTP3 PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 5.493e-32
Identity = 63/113 (55.75%), Postives = 84/113 (74.34%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSAQA-ITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            +KL    + CM+V GP++  A ++CG VSG+LA CIG+L   GP+P  CC+GV SLN  ARTTPDRQ AC CL  AA ++P++N+  AAGLP ACGV+IPYKIS +T+C+ V+
Sbjct:    5 VKLSCLVLACMIVAGPIATNAALSCGTVSGNLAACIGYLTQNGPVPTACCSGVTSLNNMARTTPDRQQACRCLVGAANALPTINVARAAGLPKACGVNIPYKISKTTNCNSVK 117          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP6_LENCU (Non-specific lipid-transfer protein 6 OS=Lens culinaris PE=1 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 7.174e-32
Identity = 66/106 (62.26%), Postives = 80/106 (75.47%), Query Frame = 1
Query:   22 VLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMP-CCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            V+CM+V  P++  AI+CG V+  L+PC+ +L +GGP P P CC GV+ L AAA TTPDRQ ACNCLK AA SI  LN NNAA LPG CGV IPYKISTST+C+ V+
Sbjct:   13 VMCMVVIAPMAEGAISCGAVTSDLSPCLTYL-TGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVDIPYKISTSTNCNTVK 117          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP_CICAR (Non-specific lipid-transfer protein OS=Cicer arietinum PE=3 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 9.370e-32
Identity = 64/112 (57.14%), Postives = 82/112 (73.21%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            +K+V   ++  +V  P++  AITCG+V  +LAPC+G+L+ G      CC GVR+LN+AA TTPDRQ ACNCLK AA SI  LN NNAA LPG C V+IPYKISTST+C+ +R
Sbjct:    4 MKVVCVALIMCIVIAPMAESAITCGRVDTALAPCLGYLQGGPGPSAQCCGGVRNLNSAAVTTPDRQAACNCLKSAAGSISRLNANNAAALPGKCVVNIPYKISTSTNCATIR 115          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP1_BRANA (Non-specific lipid-transfer protein 1 OS=Brassica napus GN=LTP1 PE=3 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 9.370e-32
Identity = 65/113 (57.52%), Postives = 81/113 (71.68%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSAQA-ITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            +KL    + CM+V GP++  A ++CG VSG+LA CIG+L   GP+P  CC GV +LN  ARTTPDRQ AC CL  AA + P+LN   AAGLP ACGV+IPYKIS ST+C+ VR
Sbjct:    5 VKLSCLVLACMIVAGPIATNAALSCGTVSGNLAACIGYLTQNGPLPRGCCTGVTNLNNMARTTPDRQQACRCLVGAANAFPTLNAARAAGLPKACGVNIPYKISKSTNCNSVR 117          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP2_LENCU (Non-specific lipid-transfer protein 2 OS=Lens culinaris PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.224e-31
Identity = 65/106 (61.32%), Postives = 81/106 (76.42%), Query Frame = 1
Query:   22 VLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMP-CCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            V+CM+V  P++  AI+CG V+  L+PC+ +L +GGP P P CC GV+ L AAA TTPDRQ ACNCLK AA SI  LN NNAA LPG CGV+IPYKIST+T+C+ V+
Sbjct:   13 VICMVVIAPMAEGAISCGAVTSDLSPCLTYL-TGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP2_GOSHI (Non-specific lipid-transfer protein OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.224e-31
Identity = 65/114 (57.02%), Postives = 81/114 (71.05%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGP--IPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            LKL    VLCM+V  PL+  A+T GQV+ SLAPCI +LR  G   +P  CC G++SLN+AA+TTP RQ AC C+K AA  I  +N   A+GLPG CGV+IPYKIS STDC+ V+
Sbjct:    7 LKLACVVVLCMVVGAPLAQGAVTSGQVTNSLAPCINYLRGSGAGAVPPGCCTGIKSLNSAAQTTPVRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCNSVK 120          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP1_GOSHI (Non-specific lipid-transfer protein OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.224e-31
Identity = 65/114 (57.02%), Postives = 81/114 (71.05%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGP--IPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            LKL    VLCM+V  PL+  A+T GQV+ SLAPCI +LR  G   +P  CC G++SLN+AA+TTP RQ AC C+K AA  I  +N   A+GLPG CGV+IPYKIS STDC+ V+
Sbjct:    3 LKLACVVVLCMVVGAPLAQGAVTSGQVTNSLAPCINYLRGSGAGAVPPGCCTGIKSLNSAAQTTPVRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCNSVK 116          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP5_LENCU (Non-specific lipid-transfer protein 5 OS=Lens culinaris PE=3 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.087e-31
Identity = 66/106 (62.26%), Postives = 82/106 (77.36%), Query Frame = 1
Query:   22 VLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMP-CCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            V+CM+V  P++  AI+CG V+G L+PC+ +L +GGP P P CC GV+ L AAA TTPDRQ ACNC+K AA SI  LN NNAA LPG CGV+IPYKISTST+C+ V+
Sbjct:   13 VMCMIVA-PMAEGAISCGAVTGDLSPCLTYL-TGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCMKSAASSITKLNTNNAAALPGKCGVNIPYKISTSTNCNTVK 116          
The following BLAST results are available for this feature:
BLAST of DC900015 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 77
Match NameE-valueIdentityDescription
NLTP1_PRUPE4.206e-3265.93Non-specific lipid-transfer protein 1 OS=Prunus pe... [more]
NLTP4_LENCU5.493e-3262.26Non-specific lipid-transfer protein 4 (Fragment) O... [more]
NLTP3_BRANA5.493e-3255.75Non-specific lipid-transfer protein 3 OS=Brassica ... [more]
NLTP6_LENCU7.174e-3262.26Non-specific lipid-transfer protein 6 OS=Lens culi... [more]
NLTP_CICAR9.370e-3257.14Non-specific lipid-transfer protein OS=Cicer ariet... [more]
NLTP1_BRANA9.370e-3257.52Non-specific lipid-transfer protein 1 OS=Brassica ... [more]
NLTP2_LENCU1.224e-3161.32Non-specific lipid-transfer protein 2 OS=Lens culi... [more]
NLTP2_GOSHI1.224e-3157.02Non-specific lipid-transfer protein OS=Gossypium h... [more]
NLTP1_GOSHI1.224e-3157.02Non-specific lipid-transfer protein OS=Gossypium h... [more]
NLTP5_LENCU2.087e-3162.26Non-specific lipid-transfer protein 5 OS=Lens culi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900015 VSS Citrus sinensis cDNA clone VS27Q25 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900015 ID=DC900015|Name=DC900015|organism=Citrus sinensis|type=EST|length=557bp
CTCAAGCTTGTTTCAGCTTGGGTTCTGTGCATGTTGGTGACTGGTCCCCT
GAGTGCTCAGGCCATAACATGTGGGCAGGTGAGTGGCTCATTGGCACCAT
GCATCGGTTTCTTGAGATCGGGCGGCCCTATACCTATGCCATGCTGCAAC
GGCGTCAGGTCTCTCAACGCTGCCGCCAGAACCACACCTGACCGCCAAAC
TGCATGCAACTGCTTGAAGCAAGCCGCCAGATCAATCCCTAGCCTCAACC
TTAATAATGCTGCTGGTCTTCCAGGAGCTTGTGGAGTCAGCATTCCTTAC
AAGATCAGCACCTCCACTGACTGCTCTAAGGTCAGGTGAACAGGAATCTG
GGCCGTTGATTTTCAGGTTTAAGTTGACGGAGTAGAATAAATGTATAATA
ATAAGGACATTTTTGTGTCCGATTTATGAGTCTCTCTCTACACTTTGTAC
TGCGAGTCTCGTTCGCGCCCTCGTTTCATGTTATGTTTTATTGGCTTTGC
TTTTCATGTCATCGGCAGNTTGGGTCTATTCTGGTTAATTAAATGAAATC
TTGCCTT
back to top