DC900015

Overview
NameDC900015
Unique NameDC900015
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length557
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10926 contig Csv1_Contig10926:991..1547. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP1_LENCU (Non-specific lipid-transfer protein 1 OS=Lens culinaris PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.400e-27
Identity = 60/107 (56.07%), Postives = 78/107 (72.90%), Query Frame = 1
Query:   22 VLCMLV-TGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMP-CCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            ++CM+V + P++  AI+CG VSG+L PC+ +L+ GGP P P CC GV+ LN AARTT DR+ ACNCLK +A SI  L   N A LPG CGV +PY ISTST+C+ +R
Sbjct:   12 LMCMVVISAPMAEAAISCGTVSGALVPCLTYLK-GGPGPSPQCCGGVKRLNGAARTTIDRRAACNCLKSSAGSISGLKPGNVATLPGKCGVRLPYTISTSTNCNTIR 117          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP2_SOLPN (Non-specific lipid-transfer protein 2 OS=Solanum pennellii GN=LTP2 PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.829e-27
Identity = 61/111 (54.95%), Postives = 77/111 (69.37%), Query Frame = 1
Query:    4 KLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            K+    +LCM+V  P  A+A+TCGQV+ +LAPC+ +L + GP+   CC GV+ L   A+TT DRQTAC CLK AA S   L+L  AA LP  C V+IPYKIS STDCSKV+
Sbjct:    6 KIACFVLLCMVVVAP-HAEALTCGQVTSTLAPCLPYLMNRGPLG-GCCGGVKGLLGQAQTTVDRQTACTCLKSAASSFTGLDLGKAASLPSTCSVNIPYKISPSTDCSKVQ 114          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: SCA_LILLO (Stigma/stylar cysteine-rich adhesin OS=Lilium longiflorum GN=SCA PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 2.388e-27
Identity = 60/97 (61.86%), Postives = 68/97 (70.10%), Query Frame = 1
Query:   52 SAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNA--AGLPGACGVSIPYKISTSTDCSKVR 336
            +A AITCGQV   L  C+G+ R GG IP  CC GVR+LN  A+TTPDRQTACNCLK      PSL LN A  AG+PG CGV+IPY I   TDC+KVR
Sbjct:   19 TASAITCGQVDSDLTSCLGYARKGGVIPPGCCAGVRTLNNLAKTTPDRQTACNCLKSLVN--PSLGLNAAIVAGIPGKCGVNIPYPIRMQTDCNKVR 113          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP2_ORYSI (Non-specific lipid-transfer protein 2 OS=Oryza sativa subsp. indica GN=LTP2-A PE=3 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 2.388e-27
Identity = 60/112 (53.57%), Postives = 75/112 (66.96%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSAQA-ITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            L LV+     +L+ GP +  A I+CGQV+ +++PC+ + R G      CC+GVRSLN+AA TT DR+TACNCLK  A SI  LN  NAA +P  CGVSIPY IS S DCS V
Sbjct:    6 LVLVALVAAALLLAGPHTTMAAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSV 117          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLT2A_ORYSJ (Non-specific lipid-transfer protein 2A OS=Oryza sativa subsp. japonica GN=LTP2-A PE=3 SV=2)

HSP 1 Score: 121.709 bits (304), Expect = 2.388e-27
Identity = 60/112 (53.57%), Postives = 75/112 (66.96%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSAQA-ITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            L LV+     +L+ GP +  A I+CGQV+ +++PC+ + R G      CC+GVRSLN+AA TT DR+TACNCLK  A SI  LN  NAA +P  CGVSIPY IS S DCS V
Sbjct:    6 LVLVALVAAALLLAGPHTTMAAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSV 117          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLT2B_ORYSJ (Non-specific lipid-transfer protein 2B OS=Oryza sativa subsp. japonica GN=LTP2-B PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 3.119e-27
Identity = 59/107 (55.14%), Postives = 73/107 (68.22%), Query Frame = 1
Query:   16 AWVLCMLVTGPLSAQA-ITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            A V  +L+ GP +  A I+CGQV+ +++PC+ + R G      CC+GVRSLN+AA TT DR+TACNCLK  A SI  LN  NAA +P  CGVSIPY IS S DCS V
Sbjct:   10 ALVAALLLAGPHTTMAAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAATTTADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSV 116          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP_BETVU (Non-specific lipid-transfer protein OS=Beta vulgaris GN=IWF1' PE=3 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 5.321e-27
Identity = 57/111 (51.35%), Postives = 75/111 (67.57%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            +K   A V+CM+V  PL A+AITCG V+  LAPCIG+L+        CC G++SLN+AA +  DR+TAC CLK AA SI  +N   AA LP  CGVS+PY IS +T+C+ +
Sbjct:    7 VKFTCALVMCMMVAAPL-AEAITCGLVASKLAPCIGYLQGAPGPSAACCGGIKSLNSAAASPADRKTACTCLKSAATSIKGINYGKAASLPRQCGVSVPYAISPNTNCNAI 116          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP5_VITSX (Non-specific lipid-transfer protein P5 OS=Vitis sp. PE=1 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 5.321e-27
Identity = 53/90 (58.89%), Postives = 69/90 (76.67%), Query Frame = 1
Query:   64 ITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            ++CG V+  LAPCI +LRS GP+P+ CCNGV++L  +A TT DR+TAC CL  A++SI  +N   AAGLPG CGV+IPYKIS ST+C +V
Sbjct:    1 LSCGDVATQLAPCINYLRSAGPLPVACCNGVKNLKNSAATTQDRRTACKCLINASKSISGVNFGLAAGLPGKCGVNIPYKISPSTNCDQV 90          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP2_SOLLC (Non-specific lipid-transfer protein 2 OS=Solanum lycopersicum GN=LE16 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 6.949e-27
Identity = 58/111 (52.25%), Postives = 76/111 (68.47%), Query Frame = 1
Query:    4 KLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            K+    V CM+V  P  A++++CG+V+  LAPC+ +L   GP+   CC GV+ L  AA+T  DR+TAC CLK AA SI  ++   AAGLPG CGV+IPYKIS STDCS V+
Sbjct:    6 KIACFVVFCMVVVAP-HAESLSCGEVTSGLAPCLPYLEGRGPLG-GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP2_SOLCI (Non-specific lipid-transfer protein 2 OS=Solanum chilense PE=3 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.185e-26
Identity = 60/111 (54.05%), Postives = 76/111 (68.47%), Query Frame = 1
Query:    4 KLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            K+    +LCM+V  P  A+A+TCGQV+ +LAPC+ +L + GP+   CC GV+ L   A+TT DRQ AC CLK AA S   L+L  AA LP  C V+IPYKIS STDCSKV+
Sbjct:    6 KIACFVLLCMVVVAP-HAEALTCGQVTSTLAPCLPYLMNRGPLG-GCCGGVKGLLGQAQTTVDRQAACACLKSAASSFTDLDLGKAASLPSTCNVNIPYKISPSTDCSKVQ 114          
The following BLAST results are available for this feature:
BLAST of DC900015 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 77
Match NameE-valueIdentityDescription
NLTP1_LENCU1.400e-2756.07Non-specific lipid-transfer protein 1 OS=Lens culi... [more]
NLTP2_SOLPN1.829e-2754.95Non-specific lipid-transfer protein 2 OS=Solanum p... [more]
SCA_LILLO2.388e-2761.86Stigma/stylar cysteine-rich adhesin OS=Lilium long... [more]
NLTP2_ORYSI2.388e-2753.57Non-specific lipid-transfer protein 2 OS=Oryza sat... [more]
NLT2A_ORYSJ2.388e-2753.57Non-specific lipid-transfer protein 2A OS=Oryza sa... [more]
NLT2B_ORYSJ3.119e-2755.14Non-specific lipid-transfer protein 2B OS=Oryza sa... [more]
NLTP_BETVU5.321e-2751.35Non-specific lipid-transfer protein OS=Beta vulgar... [more]
NLTP5_VITSX5.321e-2758.89Non-specific lipid-transfer protein P5 OS=Vitis sp... [more]
NLTP2_SOLLC6.949e-2752.25Non-specific lipid-transfer protein 2 OS=Solanum l... [more]
NLTP2_SOLCI1.185e-2654.05Non-specific lipid-transfer protein 2 OS=Solanum c... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900015 VSS Citrus sinensis cDNA clone VS27Q25 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900015 ID=DC900015|Name=DC900015|organism=Citrus sinensis|type=EST|length=557bp
CTCAAGCTTGTTTCAGCTTGGGTTCTGTGCATGTTGGTGACTGGTCCCCT
GAGTGCTCAGGCCATAACATGTGGGCAGGTGAGTGGCTCATTGGCACCAT
GCATCGGTTTCTTGAGATCGGGCGGCCCTATACCTATGCCATGCTGCAAC
GGCGTCAGGTCTCTCAACGCTGCCGCCAGAACCACACCTGACCGCCAAAC
TGCATGCAACTGCTTGAAGCAAGCCGCCAGATCAATCCCTAGCCTCAACC
TTAATAATGCTGCTGGTCTTCCAGGAGCTTGTGGAGTCAGCATTCCTTAC
AAGATCAGCACCTCCACTGACTGCTCTAAGGTCAGGTGAACAGGAATCTG
GGCCGTTGATTTTCAGGTTTAAGTTGACGGAGTAGAATAAATGTATAATA
ATAAGGACATTTTTGTGTCCGATTTATGAGTCTCTCTCTACACTTTGTAC
TGCGAGTCTCGTTCGCGCCCTCGTTTCATGTTATGTTTTATTGGCTTTGC
TTTTCATGTCATCGGCAGNTTGGGTCTATTCTGGTTAATTAAATGAAATC
TTGCCTT
back to top