DC900012

Overview
NameDC900012
Unique NameDC900012
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length872
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2213 contig Csv1_Contig2213:433..1305. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL72_ARATH (GDSL esterase/lipase At5g03810 OS=Arabidopsis thaliana GN=At5g03810 PE=3 SV=1)

HSP 1 Score: 46.9802 bits (110), Expect = 1.611e-11
Identity = 23/62 (37.10%), Postives = 33/62 (53.23%), Query Frame = 1
Query:  496 KYGFKEPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFL 681
            +YGF E  +ACCG+G    +F     C + S   C N   Y+ WDG H  EA  +V+++  L
Sbjct:  288 EYGFFESRRACCGTGTMETSF----LCNALSVGTCSNATNYVFWDGFHPSEAANRVIANNLL 345          

HSP 2 Score: 42.743 bits (99), Expect = 1.611e-11
Identity = 30/97 (30.93%), Postives = 44/97 (45.36%), Query Frame = 2
Query:  182 TSDTIRKLAIPSFTNFLQALLKRGAKYVVVQGLPTTGCLPLAMYLAPEDDRDGIG---CVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWN 463
            T D      + S++ F+Q L   GA+ + V  LP  GCLP A+ L       G+G   CV+ +N  + + N  L     NL    P   +V  D +N
Sbjct:  186 TPDQYSDHLLRSYSTFVQNLYGLGARRIGVTTLPPLGCLPAAITLF-----GGVGNNMCVERLNQDAVSFNTKLNNTSINLTNNLPGLKLVVFDIYN 277          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL42_ARATH (GDSL esterase/lipase At2g30310 OS=Arabidopsis thaliana GN=At2g30310 PE=2 SV=1)

HSP 1 Score: 48.9062 bits (115), Expect = 2.090e-11
Identity = 23/59 (38.98%), Postives = 30/59 (50.85%), Query Frame = 1
Query:  496 KYGFKEPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSD 672
            KYGFKE  K CCG+G     F       +P  K CPN   ++ WD +H  EA Y  + +
Sbjct:  294 KYGFKETKKGCCGTGYLETTFMC-----NPLTKTCPNHSDHLFWDSIHPSEAAYNYIGN 347          

HSP 2 Score: 40.4318 bits (93), Expect = 2.090e-11
Identity = 27/100 (27.00%), Postives = 46/100 (46.00%), Query Frame = 2
Query:  197 RKLAIPSFTNFLQALLKR-----------GAKYVVVQGLPTTGCLPLAMYLAPEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWN 463
            R+L  P+   + + +LKR           G + +VV GLP  GCLP+ M     +      CV+  N  S  +N  L  +L  ++   P +  +YA+ ++
Sbjct:  186 RRLEYPTIHGYQEFILKRLDGFVRELYSLGCRNIVVGGLPPMGCLPIQMTAKMRNILR--FCVEQENKDSVLYNQKLVKKLPEIQASLPGSNFLYANVYD 283          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL73_ARATH (GDSL esterase/lipase At5g03820 OS=Arabidopsis thaliana GN=At5g03820 PE=3 SV=1)

HSP 1 Score: 44.669 bits (104), Expect = 2.715e-11
Identity = 28/94 (29.79%), Postives = 42/94 (44.68%), Query Frame = 2
Query:  182 TSDTIRKLAIPSFTNFLQALLKRGAKYVVVQGLPTTGCLPLAMYLAPEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWN 463
            T D      +  ++ F+Q L   GA+ + V  LP  GCLP A+ L  E   +   CV+ +N  + + N  L     NL    P   +V  D +N
Sbjct:  186 TPDQYSDRLMKPYSTFVQNLYDLGARKIGVTTLPPLGCLPAAITLFGETGNNNT-CVERLNQDAVSFNTKLNNTSMNLTNNLPGLKLVVFDIYN 278          

HSP 2 Score: 44.2838 bits (103), Expect = 2.715e-11
Identity = 22/60 (36.67%), Postives = 31/60 (51.67%), Query Frame = 1
Query:  502 GFKEPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFL 681
            GF E  +ACCG+G    +F     C + S   C N   Y+ WDG H  EA  +V+++  L
Sbjct:  291 GFFESRRACCGTGTVETSF----LCNARSVGTCSNATNYVFWDGFHPSEAANRVIANNLL 346          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: EXL1_ARATH (GDSL esterase/lipase EXL1 OS=Arabidopsis thaliana GN=EXL1 PE=2 SV=1)

HSP 1 Score: 45.8246 bits (107), Expect = 5.927e-11
Identity = 23/68 (33.82%), Postives = 32/68 (47.06%), Query Frame = 1
Query:  496 KYGFKEPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSR 699
            +YGFK   K CCG+G       V A C + +A  CP    Y+ WD  H  E  Y+++    L    +R
Sbjct:  310 QYGFKVANKGCCGTGL----IEVTALCNNYTASVCPIRSDYVFWDSFHPTEKAYRIIVAKLLDRYLNR 373          

HSP 2 Score: 41.9726 bits (97), Expect = 5.927e-11
Identity = 41/151 (27.15%), Postives = 65/151 (43.05%), Query Frame = 2
Query:   29 QLIWFNKFLESKGCKEAESSGPQCQAAFDDALFWVGEIGVNDYA---YTLGS---SVTSDTIRKLAIPSFTNFLQALLKRGAKYVVVQGLPTTGCLPLAMYLAPEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWN 463
            QLI+F +++E       E    + +    ++LF V   G ND A   +TL       T  +   L   +  +F Q L   GA+ ++V G P  GC+P    +A    RD   CV   N+ +   N  L A +  L +      I+Y D ++
Sbjct:  156 QLIYFEEYIEKLKQMVGEK---RTKFIIKNSLFVV-ICGSNDIANDFFTLPPVRLHYTVASFTALMADNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRD---CVARFNDAAKLFNTKLSANIDVLSRTLQDPTIIYIDIYS 299          
The following BLAST results are available for this feature:
BLAST of DC900012 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 34
Match NameE-valueIdentityDescription
GDL72_ARATH1.611e-1137.10GDSL esterase/lipase At5g03810 OS=Arabidopsis thal... [more]
GDL42_ARATH2.090e-1138.98GDSL esterase/lipase At2g30310 OS=Arabidopsis thal... [more]
GDL73_ARATH2.715e-1129.79GDSL esterase/lipase At5g03820 OS=Arabidopsis thal... [more]
EXL1_ARATH5.927e-1133.82GDSL esterase/lipase EXL1 OS=Arabidopsis thaliana ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900012 VSS Citrus sinensis cDNA clone VS27Q23 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900012 ID=DC900012|Name=DC900012|organism=Citrus sinensis|type=EST|length=872bp
TGACATTACTCCTCAGTCAATCCAAACTCAGCTCATTTGGTTCAACAAGT
TCTTGGAGAGCAAGGGATGTAAAGAAGCAGAGTCCTCAGGGCCTCAGTGC
CAGGCAGCTTTCGATGATGCATTGTTCTGGGTTGGTGAAATTGGAGTCAA
CGATTATGCGTACACTCTAGGATCTTCTGTTACAAGTGACACTATCCGAA
AACTCGCTATCCCTAGTTTTACAAATTTTCTGCAGGCGTTGCTTAAAAGA
GGAGCAAAATATGTTGTTGTTCAAGGTCTGCCGACAACAGGATGCTTGCC
GCTGGCAATGTATTTGGCCCCTGAAGACGATAGAGACGGTATAGGCTGTG
TAAAAAGTGTGAACAATCAAAGCTACACCCATAACCTTGTTCTTCAAGCC
CAATTACAGAATCTTAGACAGCAGTTTCCCCAGGCTGTGATTGTATATGC
TGATTACTGGAATGCTTTCCCGCATGGTGATGAAAAATCCAGGGGAAGTA
CGGGTTCAAGGAGCCCTTCAAGGCTTGCTGCGGATCCGGTGAACCTCCTT
ACAACTTTAATGTGTTTGCTACTTGTGGCTCGCCCTCTGCAAAAGCTTGC
CCGAATCCTTATCAATACATCAACTGGGACGGAGTTCATCTCNCTGAAGC
CATGTATAAGGTGATGAGTGACATGTTTCTTAGCGGAACATTTAGTCGCC
CTCCGTTCAGCTACTTACTGAGCAGAAAGCAGCGGGACGGATGAACCTCT
TGGTTATTGAAATTGGCTAANCAATANCAATGATTGTCTTTGAGCTCTGT
ATTATTATTTTTTTTTTCCNCTTTTCAAATATGGAGCCGTTAATCAACGG
TTTAAAATTTCCAGTGAACTTG
back to top