DC900011

Overview
NameDC900011
Unique NameDC900011
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: RLK5_ARATH (Receptor-like protein kinase 5 OS=Arabidopsis thaliana GN=RLK5 PE=1 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.116e-29
Identity = 71/178 (39.89%), Postives = 110/178 (61.80%), Query Frame = 2
Query:  119 IPHIIHRDMKSSNVLLDENFEARVSDFGMARL--MSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWV-KQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATDEGG 643
            +P I+HRD+KSSN+LLD ++ A+V+DFG+A++  MS   T  ++S +AG+ GY+ PEY  + R + K D+YS+GVVLLEL+TGK+PTDS + GD ++  WV     K  +  V DP+L   D   + E+ + +H+   C    P  RP+M +V+ M +E+       S +T    + G
Sbjct:  812 VPPIVHRDVKSSNILLDSDYGAKVADFGIAKVGQMSGSKTPEAMSGIAGSCGYIAPEYVYTLRVNEKSDIYSFGVVLLELVTGKQPTDS-ELGDKDMAKWVCTALDKCGLEPVIDPKL---DLKFKEEISKVIHIGLLCTSPLPLNRPSMRKVVIMLQEVSGAVPCSSPNTSKRSKTG 985          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: PSKR2_ARATH (Phytosulfokine receptor 2 OS=Arabidopsis thaliana GN=PSKR2 PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 4.242e-29
Identity = 71/158 (44.94%), Postives = 107/158 (67.72%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGD-NNLVGWVKQ-HAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEI 589
            P++IHRD+KSSN+LLDE FEA ++DFG+ARL+   DTH++   L GT GY+PPEY QS   + +GDVYS+GVVLLEL+TG+RP +        +LV  V Q  A+ + +++ D  + +E+ N E  +L+ L +A  C+D  P RRP + +V+   +++
Sbjct:  874 PNVIHRDVKSSNILLDEKFEAHLADFGLARLLRPYDTHVTTD-LVGTLGYIPPEYSQSLIATCRGDVYSFGVVLLELVTGRRPVEVCKGKSCRDLVSRVFQMKAEKREAELIDTTI-RENVN-ERTVLEMLEIACKCIDHEPRRRPLIEEVVTWLEDL 1028          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: FEI1_ARATH (LRR receptor-like serine/threonine-protein kinase FEI 1 OS=Arabidopsis thaliana GN=FEI1 PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.234e-28
Identity = 71/157 (45.22%), Postives = 107/157 (68.15%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDN-NLVGWVK-QHAKLKISDVFDPELMKEDPNIEIELLQH-LHVASACLDDRPWRRPTMIQVMAMFK 583
            P IIHRD+KSSN+LLD N EARVSDFG+A+L+   ++H++ + +AGT GY+ PEY QS R + K DVYS+GV++LE+L+GKRPTD++      N+VGW+K   ++ +  D+ DP        +++E L   L +A+ C+   P  RPTM +V+ + +
Sbjct:  423 PRIIHRDIKSSNILLDGNLEARVSDFGLAKLLEDEESHIT-TIVAGTFGYLAPEYMQSGRATEKTDVYSFGVLVLEVLSGKRPTDASFIEKGLNVVGWLKFLISEKRPRDIVDPNC----EGMQMESLDALLSIATQCVSPSPEERPTMHRVVQLLE 574          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y2317_ARATH (Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.750e-28
Identity = 74/174 (42.53%), Postives = 103/174 (59.20%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAK--LKISDVFDPELMK-EDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATD 634
            P IIHRD+KS+N+L+DENFEA V DFG+A+++  M    SVS +AG+ GY+ PEY  + + + K D+YS+GVVLLELLTGK P    + G  +L  W + H +     S++ DP L K ED  I   ++    +A  C    P  RPTM +V+ M  E    +G    ST  +D
Sbjct:  946 PRIIHRDIKSNNILIDENFEAHVGDFGLAKVID-MPLSKSVSAVAGSYGYIAPEYAYTMKVTEKCDIYSFGVVLLELLTGKAPVQPLEQG-GDLATWTRNHIRDHSLTSEILDPYLTKVEDDVILNHMITVTKIAVLCTKSSPSDRPTMREVVLMLIESGERAGKVIVSTTCSD 1117          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y5148_ARATH (Probable leucine-rich repeat receptor-like protein kinase At5g61480 OS=Arabidopsis thaliana GN=At5g61480 PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.045e-27
Identity = 67/158 (42.41%), Postives = 100/158 (63.29%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGD-NNLVGWVKQHAKLK--ISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKE 586
            P I+HRD+K SN+LLD +FEARV+DFG+A+L+    T  S+S +AG+ GY+ PEY  + +   K D+YSYGV+LLE++TGKR  +  +FG+ N++V WV+   K K  + +V D  + +    I  E+ Q L +A  C    P  RP M  V+ + +E
Sbjct:  846 PVIVHRDLKPSNILLDADFEARVADFGVAKLIQ---TDESMSVVAGSYGYIAPEYAYTLQVDKKSDIYSYGVILLEIITGKRSVE-PEFGEGNSIVDWVRSKLKTKEDVEEVLDKSMGRSCSLIREEMKQMLRIALLCTSRSPTDRPPMRDVLLILQE 999          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: RCH1_ARATH (LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.045e-27
Identity = 67/157 (42.68%), Postives = 97/157 (61.78%), Query Frame = 2
Query:  119 IPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEI 589
            +P I+HRD+K++N+L+  +FE  + DFG+A+L+   D   S +T+AG+ GY+ PEY  S + + K DVYSYGVV+LE+LTGK+P D       ++V WVK   K++   V D  L     +   E++Q L VA  C++  P  RPTM  V AM  EI
Sbjct:  913 VPPIVHRDIKANNILIGPDFEPYIGDFGLAKLVDDGDFARSSNTIAGSYGYIAPEYGYSMKITEKSDVYSYGVVVLEVLTGKQPIDPTIPDGLHIVDWVK---KIRDIQVIDQGLQARPESEVEEMMQTLGVALLCINPIPEDRPTMKDVAAMLSEI 1066          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: SERK2_ARATH (Somatic embryogenesis receptor kinase 2 OS=Arabidopsis thaliana GN=SERK2 PE=1 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 2.328e-27
Identity = 75/179 (41.90%), Postives = 106/179 (59.22%), Query Frame = 2
Query:  107 SARGI--------PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNN---LVGWVKQHAK-LKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGL 607
            SARG+        P IIHRD+K++N+LLDE FEA V DFG+ARLM   DTH++ + + GT G++ PEY  + + S K DV+ YG++LLEL+TG+R  D A   +++   L+ WVK   K  K+  + DP+L       E+E  Q + VA  C    P  RP M +V+ M +    G GL
Sbjct:  413 SARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLARLMDYKDTHVT-TAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEMLVDPDLQSNYTEAEVE--QLIQVALLCTQSSPMERPKMSEVVRMLE----GDGL 584          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y1743_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g74360 OS=Arabidopsis thaliana GN=At1g74360 PE=1 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 3.040e-27
Identity = 71/174 (40.80%), Postives = 108/174 (62.07%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKLKISDVFDPELMK--EDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEI----QAGSGLDSQSTI 625
            P I+HRD+K+SNVLLD++  ARV+DFG+ARL++  D+H+S + +AGT GYV PEY Q+++ +T+GDVYSYGV+ +EL TG+R  D    G+  LV W ++     ++    P  +   +  N   ++ + L +   C  D P  RP M +V+AM  +I    +  +GL SQ  I
Sbjct:  935 PSIVHRDVKASNVLLDKHGNARVTDFGLARLLNVGDSHVS-TVIAGTIGYVAPEYGQTWQATTRGDVYSYGVLTMELATGRRAVDG---GEECLVEWARRVMTGNMTAKGSPITLSGTKPGNGAEQMTELLKIGVKCTADHPQARPNMKEVLAMLVKISGKAELFNGLSSQGYI 1104          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y1677_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g67720 OS=Arabidopsis thaliana GN=At1g67720 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 3.040e-27
Identity = 78/200 (39.00%), Postives = 117/200 (58.50%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFG-DNNLVGWVKQ-HAKLKISDVFDPELMKEDPNIEIELLQHL-HVASACLDDRPWRRPTMIQVMAMFKE---IQAG--SGLDSQSTIATDEGGFGTVEMVEMSIQEAPELS 697
            P IIHRD+KSSN+LLD N  A+VSDFG++R      TH+S S   GT GY+ PEYY S + + K DVYS+GVVL ELL+GK+P  + DFG + N+V W +    K  +  + DP +     N++IE +  +  VA+ C++ R   RP M +V+   ++   I+ G  +GL S S+ ++         +      E+P++S
Sbjct:  725 PSIIHRDVKSSNILLDINMRAKVSDFGLSRQTEEDLTHVS-SVAKGTVGYLDPEYYASQQLTEKSDVYSFGVVLFELLSGKKPVSAEDFGPELNIVHWARSLIRKGDVCGIIDPCIAS---NVKIESVWRVAEVANQCVEQRGHNRPRMQEVIVAIQDAIRIERGNENGLKSSSSSSSKAQSSRKTLLTSFLELESPDIS 920          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: RCH2_ARATH (Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 6.773e-27
Identity = 66/158 (41.77%), Postives = 97/158 (61.39%), Query Frame = 2
Query:  119 IPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQ 592
            +P I+HRD+K++N+L+  +FE  ++DFG+A+L+   D     +T+AG+ GY+ PEY  S + + K DVYSYGVV+LE+LTGK+P D       +LV WV+Q+      +V D  L         E++Q L  A  C++  P  RPTM  V AM KEI+
Sbjct:  912 LPPIVHRDIKANNILIGLDFEPYIADFGLAKLVDEGDIGRCSNTVAGSYGYIAPEYGYSMKITEKSDVYSYGVVVLEVLTGKQPIDPTVPEGIHLVDWVRQNR--GSLEVLDSTLRSRTEAEADEMMQVLGTALLCVNSSPDERPTMKDVAAMLKEIK 1067          
The following BLAST results are available for this feature:
BLAST of DC900011 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 291
Match NameE-valueIdentityDescription
RLK5_ARATH1.116e-2939.89Receptor-like protein kinase 5 OS=Arabidopsis thal... [more]
PSKR2_ARATH4.242e-2944.94Phytosulfokine receptor 2 OS=Arabidopsis thaliana ... [more]
FEI1_ARATH1.234e-2845.22LRR receptor-like serine/threonine-protein kinase ... [more]
Y2317_ARATH2.750e-2842.53Probable leucine-rich repeat receptor-like protein... [more]
Y5148_ARATH1.045e-2742.41Probable leucine-rich repeat receptor-like protein... [more]
RCH1_ARATH1.045e-2742.68LRR receptor-like serine/threonine-protein kinase ... [more]
SERK2_ARATH2.328e-2741.90Somatic embryogenesis receptor kinase 2 OS=Arabido... [more]
Y1743_ARATH3.040e-2740.80Probable LRR receptor-like serine/threonine-protei... [more]
Y1677_ARATH3.040e-2739.00Probable LRR receptor-like serine/threonine-protei... [more]
RCH2_ARATH6.773e-2741.77Receptor-like protein kinase 2 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900011 VSS Citrus sinensis cDNA clone VS27Q22 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900011 ID=DC900011|Name=DC900011|organism=Citrus sinensis|type=EST|length=850bp
GTTTTTTTTTTTTTTTTTTTAGAGAAAATAGAAATTTTTATATATTAAAA
GGGAAAGGAAGAAACAGACTAGAAAAAAAAAAACTCGAGACTAGCTCGTG
CCGAATTCGGCACGAGGCATCCCACACATTATCCACCGGGATATGAAATC
GAGCAATGTTCTGCTAGACGAAAACTTTGAGGCCAGAGTCTCAGATTTTG
GAATGGCAAGACTAATGAGTGCGATGGATACACATTTGAGTGTCAGTACG
CTAGCAGGCACACCCGGCTATGTCCCTCCCGAATACTATCAAAGCTTTAG
ATGTTCGACGAAAGGCGATGTTTACAGTTATGGTGTAGTTTTGCTCGAGT
TGCTAACGGGAAAAAGGCCAACAGATTCAGCAGATTTCGGTGACAATAAC
CTAGTTGGGTGGGTAAAGCAGCATGCGAAGCTGAAAATAAGCGATGTCTT
TGATCCAGAACTCATGAAAGAGGATCCAAACATCGAGATTGAGCTTCTTC
AACACTTGCATGTAGCGAGTGCTTGCCTGGATGATCGACCATGGAGGAGA
CCGACAATGATTCAGGTTATGGCAATGTTTAAAGAAATCCAAGCCGGTTC
AGGACTTGACTCGCAATCTACTATTGCCACTGATGAAGGAGGTTTCGGTA
CAGTCGAAATGGTAGAGATGAGCATCCAAGAAGCTCCAGAACTAAGCACC
AAGCCTTAGNCCATTCAATTTTCAGGACAAGCATTCTTTCAGTGCCCCAA
AATTTTCCCACTTGAAAACCAAAAAAGTTGCCTTTGGTATCTCTACCATT
TAGTGTATGTAATCTTTGTATCCCTTTTGAAAATTCTTGTTATTTATACA
back to top