DC900011

Overview
NameDC900011
Unique NameDC900011
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y2239_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At2g23950 OS=Arabidopsis thaliana GN=At2g23950 PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 7.009e-24
Identity = 70/182 (38.46%), Postives = 109/182 (59.89%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDN-----NLVGWV-KQHAKLKISDVFDPELMKEDPNIEI-ELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATDEGGF 646
            P IIHRD+K++N+LLDE FEA V DFG+A+L++  D+H++ + + GT G++ PEY  + + S K DV+ +G++LLEL+TG R   + +FG +      ++ WV K H ++K+ ++ D EL      IE+ E+LQ   VA  C    P  RP M +V+ M +    G GL  +   + D   F
Sbjct:  416 PKIIHRDVKAANILLDEYFEAVVGDFGLAKLLNHEDSHVT-TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGMR---ALEFGKSVSQKGAMLEWVRKLHKEMKVEELVDRELGTTYDRIEVGEMLQ---VALLCTQFLPAHRPKMSEVVQMLE----GDGLAERWAASHDHSHF 586          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: IMK3_ARATH (Probable leucine-rich repeat receptor-like protein kinase IMK3 OS=Arabidopsis thaliana GN=IMK3 PE=1 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 7.009e-24
Identity = 72/173 (41.62%), Postives = 102/173 (58.96%), Query Frame = 2
Query:   95 LVPNSARGI------PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKLK-ISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQ 592
            L+   ARG+       +IIH ++ SSNVLLDEN  A++SD+G++RLM+A     SV   AG  GY  PE  +  + +TK DVYS GV++LELLTGK P+++ +  D  L  WV    K +  ++VFD EL+ +   +  E+L  L +A  C+D  P  RP   QVM    EI+
Sbjct:  591 LIKGMARGLFYLHTHANIIHGNLTSSNVLLDENITAKISDYGLSRLMTAA-AGSSVIATAGALGYRAPELSKLKKANTKTDVYSLGVIILELLTGKSPSEALNGVD--LPQWVATAVKEEWTNEVFDLELLNDVNTMGDEILNTLKLALHCVDATPSTRPEAQQVMTQLGEIR 760          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: RLK7_ARATH (Receptor-like protein kinase At5g59670 OS=Arabidopsis thaliana GN=At5g59670 PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 9.154e-24
Identity = 63/156 (40.38%), Postives = 96/156 (61.54%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVK-QHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKE 586
            P ++HRD+K++N+LLDENF+A+++DFG++R           +T+AGT GY+ PE Y S R   K DVYS+G+VLLE++T  +P  +   GD+++  WV  Q  +  I ++ DP L K D NI     + L +A +C      +RP+M QV+   KE
Sbjct:  683 PPMVHRDVKTANILLDENFKAKLADFGLSRSFQGEGESQESTTIAGTLGYLDPECYHSGRLGEKSDVYSFGIVLLEMIT-NQPVINQTSGDSHITQWVGFQMNRGDILEIMDPNLRK-DYNIN-SAWRALELAMSCAYPSSSKRPSMSQVIHELKE 835          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: HSL2_ARATH (LRR receptor-like serine/threonine-protein kinase HSL2 OS=Arabidopsis thaliana GN=HSL2 PE=2 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 1.196e-23
Identity = 68/181 (37.57%), Postives = 101/181 (55.80%), Query Frame = 2
Query:  119 IPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMD----THLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKL---------------------KISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKE 586
            +P I+HRD+KS+N+LLD   + RV+DFG+A+ +   D    + +S+S +AG+ GY+ PEY  + + + K DVYS+GVVLLEL+TGKRP DS+ FG+N  +      A L                      +S + DP++       E E+ + L VA  C    P  RPTM +V+ + KE
Sbjct:  810 VPPIVHRDVKSNNILLDHEMKPRVADFGLAKPLKREDNDGVSDVSMSCVAGSYGYIAPEYGYTSKVNEKSDVYSFGVVLLELITGKRPNDSS-FGENKDIVKFAMEAALCYPSPSAEDGAMNQDSLGNYRDLSKLVDPKMKLSTREYE-EIEKVLDVALLCTSSFPINRPTMRKVVELLKE 988          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y2296_ARATH (Probable receptor-like protein kinase At2g42960 OS=Arabidopsis thaliana GN=At2g42960 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 2.663e-23
Identity = 60/156 (38.46%), Postives = 95/156 (60.90%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTD-SADFGDNNLVGWVKQH-AKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFK 583
            P ++HRD+K+SN+L+D+ F A++SDFG+A+L+ + ++H++   + GT GYV PEY  +   + K D+YS+GV+LLE +TG+ P D      + NLV W+K      +  +V DP L  E    +  L + L V+  C+D    +RP M QV  M +
Sbjct:  303 PKVVHRDIKASNILIDDEFNAKLSDFGLAKLLDSGESHITTRVM-GTFGYVAPEYANTGLLNEKSDIYSFGVLLLEAITGRDPVDYGRPANEVNLVEWLKMMVGTRRAEEVVDPRL--EPRPSKSALKRALLVSLRCVDPEAEKRPRMSQVARMLE 455          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y1154_ARATH (Probable serine/threonine-protein kinase At1g01540 OS=Arabidopsis thaliana GN=At1g01540 PE=1 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 3.479e-23
Identity = 58/156 (37.18%), Postives = 97/156 (62.18%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTD-SADFGDNNLVGWVKQH-AKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFK 583
            P ++HRD+KSSN+LLD  + A+VSDFG+A+L+ +  ++++   + GT GYV PEY  +   + K D+YS+G++++E++TG+ P D S   G+ NLV W+K      +  +V DP++   +P     L + L VA  C+D    +RP M  ++ M +
Sbjct:  274 PKVVHRDIKSSNILLDRQWNAKVSDFGLAKLLGSESSYVTTRVM-GTFGYVAPEYACTGMLNEKSDIYSFGILIMEIITGRNPVDYSRPQGETNLVDWLKSMVGNRRSEEVVDPKI--PEPPSSKALKRVLLVALRCVDPDANKRPKMGHIIHMLE 426          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: WAKLB_ARATH (Wall-associated receptor kinase-like 2 OS=Arabidopsis thaliana GN=WAKL2 PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 3.479e-23
Identity = 71/183 (38.80%), Postives = 113/183 (61.75%), Query Frame = 2
Query:  104 NSARGIPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDN-----NLVGWVKQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATDE 637
            +SA   P I HRD+K++N+LLDE   A+VSDFG +R ++   THL+   +AGT GYV PEY+QS + + K DVYS+GVVL+ELLTG++P+      +N     + V  VK++  L I D    + +K++ N++ +++   ++A  CL+ +  +RP M +V    + I++ S  DS   I  D+
Sbjct:  530 HSAASFP-IYHRDIKTTNILLDERNRAKVSDFGTSRSVTIDQTHLTTQ-VAGTFGYVDPEYFQSSKFTEKSDVYSFGVVLVELLTGEKPSSRVRSEENRGLAAHFVEAVKENRVLDIVD----DRIKDECNMD-QVMSVANLARRCLNRKGKKRPNMREVSIELEMIRS-SHYDSGIHIEDDD 704          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: RPK1_IPONI (Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 3.479e-23
Identity = 60/154 (38.96%), Postives = 93/154 (60.39%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQ--HAKLKISDVFDPELMKE--DPNIEIELLQHLHVASACLDDRPWRRPTMIQVM 571
            P I+HRD+K  N+LLD + E  +SDFG+A+L+    T +  +T+ GT GY+ PE   +   S + DVYSYGVVLLEL+T K+  D +  G+ ++VGWV+       +I  + DP L+ E  D ++  ++ + L +A  C +    +RPTM  V+
Sbjct:  936 PAIVHRDIKPMNILLDSDLEPHISDFGIAKLLDQSATSIPSNTVQGTIGYMAPENAFTTVKSRESDVYSYGVVLLELITRKKALDPSFNGETDIVGWVRSVWTQTGEIQKIVDPSLLDELIDSSVMEQVTEALSLALRCAEKEVDKRPTMRDVV 1089          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y5838_ARATH (Probably inactive leucine-rich repeat receptor-like protein kinase At5g48380 OS=Arabidopsis thaliana GN=At5g48380 PE=1 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 4.543e-23
Identity = 67/169 (39.64%), Postives = 99/169 (58.58%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLS--VSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGD---------NNLVGWV-KQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASAC-LDDRPWRRPTMIQVMAMFKEI 589
            P IIHR++ S  +LL   FE ++SDFG+ARLM+ +DTHLS  V+   G  GYV PEY ++   + KGDVYS+GVVLLEL+TG++ T      +          NLV W+ K  ++ K+ +  D  L+     ++ E+ + L VA  C L +   +RPTM +V  + + I
Sbjct:  423 PRIIHRNISSKCILLTAEFEPKISDFGLARLMNPIDTHLSTFVNGEFGDFGYVAPEYSRTMVATPKGDVYSFGVVLLELVTGQKATSVTKVSEEKAEEENFKGNLVEWITKLSSESKLQEAIDRSLLGN--GVDDEIFKVLKVACNCVLPEIAKQRPTMFEVYQLLRAI 589          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y5169_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g16900 OS=Arabidopsis thaliana GN=At5g16900 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 4.543e-23
Identity = 58/156 (37.18%), Postives = 97/156 (62.18%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSA-MDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKE 586
            P ++HRD+KS N+LLDE+F+A+++DFG++R  S   ++H+S   + GTPGY+ PEYY+++R + K DVYS+G+VLLE++T +   + A+   +          +  IS + DP L+ E  +  +   + L +A +C+D  P  RP M  V+   K+
Sbjct:  692 PLMVHRDVKSMNILLDEHFQAKLADFGLSRSFSVGEESHVSTGVV-GTPGYLDPEYYRTYRLTEKSDVYSFGIVLLEIITNQPVLEQANENRHIAERVRTMLTRSDISTIVDPNLIGEYDSGSVR--KALKLAMSCVDPSPVARPDMSHVVQELKQ 844          
The following BLAST results are available for this feature:
BLAST of DC900011 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 291
Match NameE-valueIdentityDescription
Y2239_ARATH7.009e-2438.46Probable LRR receptor-like serine/threonine-protei... [more]
IMK3_ARATH7.009e-2441.62Probable leucine-rich repeat receptor-like protein... [more]
RLK7_ARATH9.154e-2440.38Receptor-like protein kinase At5g59670 OS=Arabidop... [more]
HSL2_ARATH1.196e-2337.57LRR receptor-like serine/threonine-protein kinase ... [more]
Y2296_ARATH2.663e-2338.46Probable receptor-like protein kinase At2g42960 OS... [more]
Y1154_ARATH3.479e-2337.18Probable serine/threonine-protein kinase At1g01540... [more]
WAKLB_ARATH3.479e-2338.80Wall-associated receptor kinase-like 2 OS=Arabidop... [more]
RPK1_IPONI3.479e-2338.96Receptor-like protein kinase OS=Ipomoea nil GN=INR... [more]
Y5838_ARATH4.543e-2339.64Probably inactive leucine-rich repeat receptor-lik... [more]
Y5169_ARATH4.543e-2337.18Probable LRR receptor-like serine/threonine-protei... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900011 VSS Citrus sinensis cDNA clone VS27Q22 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900011 ID=DC900011|Name=DC900011|organism=Citrus sinensis|type=EST|length=850bp
GTTTTTTTTTTTTTTTTTTTAGAGAAAATAGAAATTTTTATATATTAAAA
GGGAAAGGAAGAAACAGACTAGAAAAAAAAAAACTCGAGACTAGCTCGTG
CCGAATTCGGCACGAGGCATCCCACACATTATCCACCGGGATATGAAATC
GAGCAATGTTCTGCTAGACGAAAACTTTGAGGCCAGAGTCTCAGATTTTG
GAATGGCAAGACTAATGAGTGCGATGGATACACATTTGAGTGTCAGTACG
CTAGCAGGCACACCCGGCTATGTCCCTCCCGAATACTATCAAAGCTTTAG
ATGTTCGACGAAAGGCGATGTTTACAGTTATGGTGTAGTTTTGCTCGAGT
TGCTAACGGGAAAAAGGCCAACAGATTCAGCAGATTTCGGTGACAATAAC
CTAGTTGGGTGGGTAAAGCAGCATGCGAAGCTGAAAATAAGCGATGTCTT
TGATCCAGAACTCATGAAAGAGGATCCAAACATCGAGATTGAGCTTCTTC
AACACTTGCATGTAGCGAGTGCTTGCCTGGATGATCGACCATGGAGGAGA
CCGACAATGATTCAGGTTATGGCAATGTTTAAAGAAATCCAAGCCGGTTC
AGGACTTGACTCGCAATCTACTATTGCCACTGATGAAGGAGGTTTCGGTA
CAGTCGAAATGGTAGAGATGAGCATCCAAGAAGCTCCAGAACTAAGCACC
AAGCCTTAGNCCATTCAATTTTCAGGACAAGCATTCTTTCAGTGCCCCAA
AATTTTCCCACTTGAAAACCAAAAAAGTTGCCTTTGGTATCTCTACCATT
TAGTGTATGTAATCTTTGTATCCCTTTTGAAAATTCTTGTTATTTATACA
back to top