DC900011

Overview
NameDC900011
Unique NameDC900011
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: WAKLR_ARATH (Wall-associated receptor kinase-like 21 OS=Arabidopsis thaliana GN=WAKL21 PE=1 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 4.543e-23
Identity = 67/194 (34.54%), Postives = 109/194 (56.19%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMD---THLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTD-SADFGDNNLVGW-VKQHAKLKISDVFDPELMKE-DPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATDEGGFGTVEMVEMSIQEA 685
            P I HRD+KSSN+LLD  F +++SDFG++RL  + D   +H+S +   GTPGY+ P+Y+Q F+ S K DVYS+GVVL+E+++G +  D +  + + NL    V +  + ++ D+ DP L KE +P +   +     +A  CL      RPTM+++      I+            T+ G F     ++M  Q++
Sbjct:  431 PPIYHRDIKSSNILLDHEFNSKISDFGLSRLGMSTDFEASHISTAP-QGTPGYLDPQYHQDFQLSDKSDVYSFGVVLVEIISGFKVIDFTRPYSEVNLASLAVDRIGRGRVVDIIDPCLNKEINPKMFASIHNLAELAFRCLSFHRNMRPTMVEITEDLHRIKL-------MHYGTESGKFKNRSEIDMKRQQS 616          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: WAKLP_ARATH (Wall-associated receptor kinase-like 15 OS=Arabidopsis thaliana GN=WAKL15 PE=2 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 4.543e-23
Identity = 72/160 (45.00%), Postives = 102/160 (63.75%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTD-SADFGDNNLVGWVKQHAKL-KISDVFDPELMKEDPNIEIELLQHLHV-ASACLDDRPWRRPTMIQVMAMFKEIQ 592
            P I HRD+KSSN+LLDEN + +V+DFG++RL  +  +H++     GT GY+ PEYY +F+ + K DVYS+GVVL ELLT K+  D + +  D NLV +V++  K  ++ DV DP +       EIE ++ L V A  C+ +    RPTM QV A  KEI+
Sbjct:  478 PPIYHRDVKSSNILLDENLDVKVADFGLSRLGVSDVSHVTTCA-QGTLGYLDPEYYLNFQLTDKSDVYSFGVVLFELLTCKKAIDFNREEEDVNLVVFVRKALKEGRLMDVIDPVIGIGATEKEIESMKALGVLAELCVKETRQCRPTM-QVAA--KEIE 633          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y5977_ARATH (Probable leucine-rich repeat receptor-like protein kinase At5g49770 OS=Arabidopsis thaliana GN=At5g49770 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 5.934e-23
Identity = 61/177 (34.46%), Postives = 102/177 (57.63%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKL-KISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATDEGGFG 649
            P IIHRD+KS+N+LLDE+  A+V+DFG+++L+   +     + + GT GY+ PEYY + + + K DVY +GVV+LELLTGK P D   +    +   + +   L  + ++ D  +++   N++    +++ VA  C++     RPTM +V+   + I    GL+  +  AT E   G
Sbjct:  752 PPIIHRDVKSNNILLDEHLTAKVADFGLSKLVGDPEKAHVTTQVKGTMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIDRGSYVVKEVKKKMDKSRNLYDLQELLDTTIIQNSGNLK-GFEKYVDVALQCVEPEGVNRPTMSEVVQELESILRLVGLNPNADSATYEEASG 927          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y5487_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g48740 OS=Arabidopsis thaliana GN=At5g48740 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 5.934e-23
Identity = 59/158 (37.34%), Postives = 95/158 (60.13%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDN-NLVGWVKQHAKLKISDVFDPELMKE--DPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKE 586
            P IIHRD+KSSN+LLD++  A+VSDFG+++  +  D     + + GT GY+ PEYY + + + K DVYS+GVVLLEL+ G+ P   +   D+ NLV W + + +    ++ D +++KE  DP     + +   +A  C+      RP++ +V+   KE
Sbjct:  726 PRIIHRDVKSSNILLDKDMNAKVSDFGLSKQFTKADASHITTVVKGTAGYLDPEYYSTLQLTEKSDVYSFGVVLLELICGREPLSHSGSPDSFNLVLWARPNLQAGAFEIVD-DILKETFDP---ASMKKAASIAIRCVGRDASGRPSIAEVLTKLKE 879          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: GSO2_ARATH (LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2)

HSP 1 Score: 108.227 bits (269), Expect = 5.934e-23
Identity = 63/159 (39.62%), Postives = 93/159 (58.49%), Query Frame = 2
Query:  119 IPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSA-MDTHLSVSTL-AGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVK--------QHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQ 565
            +P I+HRD+KSSNVLLD N EA + DFG+A++++   DT+   +T+ AG+ GY+ PEY  S + + K DVYS G+VL+E++TGK PT++    + ++V WV+          A+ K+    D EL    P  E    Q L +A  C    P  RP+  Q
Sbjct: 1072 VPPIVHRDIKSSNVLLDSNIEAHLGDFGLAKILTGNYDTNTESNTMFAGSYGYIAPEYAYSLKATEKSDVYSMGIVLMEIVTGKMPTEAMFDEETDMVRWVETVLDTPPGSEAREKL---IDSELKSLLPCEEEAAYQVLEIALQCTKSYPQERPSSRQ 1227          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y1124_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g12460 OS=Arabidopsis thaliana GN=At1g12460 PE=1 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 7.749e-23
Identity = 62/167 (37.13%), Postives = 98/167 (58.68%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEY-YQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKLKI-----SDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSG 604
            P I+H ++KS+N+LLDE +EA++SD+G+ + +  MD+           GY+ PE   QS R S K DVYSYGVVLLEL+TG++P +S      N V  ++ + +  +     SD FD  L + + N   EL+Q + +   C  + P +RP+M +V+ + + I+ G G
Sbjct:  721 PAILHLNVKSTNILLDERYEAKLSDYGLEKFLPVMDSFGLTKKFHNAVGYIAPELAQQSLRASEKCDVYSYGVVLLELVTGRKPVESP---SENQVLILRDYVRDLLETGSASDCFDRRLREFEEN---ELIQVMKLGLLCTSENPLKRPSMAEVVQVLESIRNGFG 881          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: BIK1_ARATH (Serine/threonine-protein kinase BIK1 OS=Arabidopsis thaliana GN=BIK1 PE=1 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 7.749e-23
Identity = 70/194 (36.08%), Postives = 107/194 (55.15%), Query Frame = 2
Query:  128 IIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTD-SADFGDNNLVGWVKQH--AKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATD--EGGF--GTVEMVEMSIQEAP 688
            +I+RD+K+SN+LLD ++ A++SDFG+AR     D     + + GT GY  PEY  S   + + DVYS+GV+LLE+L+GKR  D +    + NLV W + +  +K K+  + D  L  +   +  E ++   VA  CL   P  RPTM QV+   +++Q   G  SQ+    D  + GF  GT +  E    + P
Sbjct:  198 VIYRDIKASNILLDADYNAKLSDFGLARDGPMGDLSYVSTRVMGTYGYAAPEYMSSGHLNARSDVYSFGVLLLEILSGKRALDHNRPAKEENLVDWARPYLTSKRKVLLIVDNRL--DTQYLPEEAVRMASVAVQCLSFEPKSRPTMDQVVRALQQLQDNLGKPSQTNPVKDTKKLGFKTGTTKSSEKRFTQKP 389          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y1719_ARATH (Probable inactive receptor kinase At1g27190 OS=Arabidopsis thaliana GN=At1g27190 PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.726e-22
Identity = 62/168 (36.90%), Postives = 98/168 (58.33%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLA--GTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRP---TDSADFGDNNLVGWVKQHAKL-KISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGL 607
            P  +H+ + S+ +LLD++F+AR++D+G+A+L+ + D++ S       G  GYV PEY  +   S KGDVY +G+VLLEL+TG++P    +  +    +LV WV Q+    +  D  D  +   D   + E+LQ L +A +C+  RP  RPTMIQV    K +    G+
Sbjct:  420 PPYLHQFISSNVILLDDDFDARITDYGLAKLVGSRDSNDSSFNNGDLGELGYVAPEYSSTMVASLKGDVYGFGIVLLELVTGQKPLSVINGVEGFKGSLVDWVSQYLGTGRSKDAIDRSIC--DKGHDEEILQFLKIACSCVVSRPKERPTMIQVYESLKNMADKHGV 585          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: PBS1_ARATH (Serine/threonine-protein kinase PBS1 OS=Arabidopsis thaliana GN=PBS1 PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.726e-22
Identity = 62/153 (40.52%), Postives = 88/153 (57.52%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDS-ADFGDNNLVGWVKQ--HAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVM 571
            P +I+RD KSSN+LLDE F  ++SDFG+A+L    D     + + GT GY  PEY  + + + K DVYS+GVV LEL+TG++  DS    G+ NLV W +   + + K   + DP L    P     L Q L VAS C+ ++   RP +  V+
Sbjct:  207 PPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSEMPHGEQNLVAWARPLFNDRRKFIKLADPRLKGRFPT--RALYQALAVASMCIQEQAATRPLIADVV 357          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: ERL2_ARATH (LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.726e-22
Identity = 65/156 (41.67%), Postives = 92/156 (58.97%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKLKISDVFDPELMKE-DPNIEIELLQHLHV------ASACLDDRPWRRPTMIQV 568
            P IIHRD+KSSN+LLD NFEAR+SDFG+A+ + A  T+ S   L GT GY+ PEY ++ R + K D+YS+G+VLLELLTGK+  D+    + NL        ++ +S   D  +M+  D  + +  +   H+      A  C    P  RPTM +V
Sbjct:  770 PRIIHRDIKSSNILLDGNFEARLSDFGIAKSIPATKTYASTYVL-GTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDN----EANL-------HQMILSKADDNTVMEAVDAEVSVTCMDSGHIKKTFQLALLCTKRNPLERPTMQEV 913          
The following BLAST results are available for this feature:
BLAST of DC900011 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 291
Match NameE-valueIdentityDescription
WAKLR_ARATH4.543e-2334.54Wall-associated receptor kinase-like 21 OS=Arabido... [more]
WAKLP_ARATH4.543e-2345.00Wall-associated receptor kinase-like 15 OS=Arabido... [more]
Y5977_ARATH5.934e-2334.46Probable leucine-rich repeat receptor-like protein... [more]
Y5487_ARATH5.934e-2337.34Probable LRR receptor-like serine/threonine-protei... [more]
GSO2_ARATH5.934e-2339.62LRR receptor-like serine/threonine-protein kinase ... [more]
Y1124_ARATH7.749e-2337.13Probable LRR receptor-like serine/threonine-protei... [more]
BIK1_ARATH7.749e-2336.08Serine/threonine-protein kinase BIK1 OS=Arabidopsi... [more]
Y1719_ARATH1.726e-2236.90Probable inactive receptor kinase At1g27190 OS=Ara... [more]
PBS1_ARATH1.726e-2240.52Serine/threonine-protein kinase PBS1 OS=Arabidopsi... [more]
ERL2_ARATH1.726e-2241.67LRR receptor-like serine/threonine-protein kinase ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900011 VSS Citrus sinensis cDNA clone VS27Q22 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900011 ID=DC900011|Name=DC900011|organism=Citrus sinensis|type=EST|length=850bp
GTTTTTTTTTTTTTTTTTTTAGAGAAAATAGAAATTTTTATATATTAAAA
GGGAAAGGAAGAAACAGACTAGAAAAAAAAAAACTCGAGACTAGCTCGTG
CCGAATTCGGCACGAGGCATCCCACACATTATCCACCGGGATATGAAATC
GAGCAATGTTCTGCTAGACGAAAACTTTGAGGCCAGAGTCTCAGATTTTG
GAATGGCAAGACTAATGAGTGCGATGGATACACATTTGAGTGTCAGTACG
CTAGCAGGCACACCCGGCTATGTCCCTCCCGAATACTATCAAAGCTTTAG
ATGTTCGACGAAAGGCGATGTTTACAGTTATGGTGTAGTTTTGCTCGAGT
TGCTAACGGGAAAAAGGCCAACAGATTCAGCAGATTTCGGTGACAATAAC
CTAGTTGGGTGGGTAAAGCAGCATGCGAAGCTGAAAATAAGCGATGTCTT
TGATCCAGAACTCATGAAAGAGGATCCAAACATCGAGATTGAGCTTCTTC
AACACTTGCATGTAGCGAGTGCTTGCCTGGATGATCGACCATGGAGGAGA
CCGACAATGATTCAGGTTATGGCAATGTTTAAAGAAATCCAAGCCGGTTC
AGGACTTGACTCGCAATCTACTATTGCCACTGATGAAGGAGGTTTCGGTA
CAGTCGAAATGGTAGAGATGAGCATCCAAGAAGCTCCAGAACTAAGCACC
AAGCCTTAGNCCATTCAATTTTCAGGACAAGCATTCTTTCAGTGCCCCAA
AATTTTCCCACTTGAAAACCAAAAAAGTTGCCTTTGGTATCTCTACCATT
TAGTGTATGTAATCTTTGTATCCCTTTTGAAAATTCTTGTTATTTATACA
back to top