DC900011

Overview
NameDC900011
Unique NameDC900011
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: CRK29_ARATH (Cysteine-rich receptor-like protein kinase 29 OS=Arabidopsis thaliana GN=CRK29 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.726e-22
Identity = 60/156 (38.46%), Postives = 91/156 (58.33%), Query Frame = 2
Query:  128 IIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDT--HLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGD---NNLVGWV-KQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAM 577
            IIHRD+K+SN+LLD+    +++DFG+A+L  +  T  H   S +AGT GY+ PEY    + S K DV+S+GV+++E++TGKR  +    GD    +L+ WV +   +  I  V DP L     N   E+L+ +H+   C+ +    RPTM  V  M
Sbjct:  478 IIHRDLKASNILLDQEMNPKIADFGLAKLFDSGQTMTHRFTSRIAGTYGYMAPEYAMHGQFSVKTDVFSFGVLVIEIITGKRNNNGGSNGDEDAEDLLSWVWRSWREDTILSVIDPSLTAGSRN---EILRCIHIGLLCVQESAATRPTMATVSLM 630          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: ACCR4_ARATH (Serine/threonine-protein kinase-like protein CCR4 OS=Arabidopsis thaliana GN=CCR4 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.255e-22
Identity = 66/165 (40.00%), Postives = 104/165 (63.03%), Query Frame = 2
Query:  119 IPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMD---THLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTG-KRPTDSADFGDNNLVGWVKQHAKL-KISDVFDPELMKEDPNIEIELLQHL-HVASACLDDRPWRRPTMIQVMAMFKEIQA 595
            +P +IHRD+KSSN+LLD  + A+VSDFG++++    +   +HLS+   AGT GY+ PEYY+  + +TK DVYS+GVVLLELL+G K   ++ D    NLV +V  +  L +   + D  +    P  EIE + H+ ++A+ CL     +RP+M++V++  +   A
Sbjct:  572 VPPVIHRDIKSSNILLDATWTAKVSDFGLSQMGPTEEDDVSHLSLHA-AGTLGYIDPEYYKFQQLTTKSDVYSFGVVLLELLSGHKAIHNNEDENPRNLVEYVVPYILLDEAHRILDQRIPPPTP-YEIEAVAHVGYLAAECLMPCSRKRPSMVEVVSKLESALA 734          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: CRI4_MAIZE (Putative receptor protein kinase CRINKLY4 OS=Zea mays GN=CR4 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.945e-22
Identity = 75/192 (39.06%), Postives = 110/192 (57.29%), Query Frame = 2
Query:  107 SARGI--------PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTL-AGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKLKISDVF---DPELMKEDPNIEIELLQHL-HVASACLDDRPWRRPTMIQVMAMFKEIQA---GSGLDSQSTIATD 634
            +ARGI        P +IHRD+KSSN+L+DE+  ARV+DFG++ ++   D+   +S L AGT GY+ PEYY+    +TK DVYS+GVVLLE+L+G++  D   F + N+V W      +K  D+F   DP L    P  ++E L+ +  VA  C+  R   RP+M +V    +   A   GS    Q  + T+
Sbjct:  615 AARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLS-ILGPADSGTPLSELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAID-MQFEEGNIVEWAV--PLIKAGDIFAILDPVL---SPPSDLEALKKIASVACKCVRMRGKDRPSMDKVTTALEHALALLMGSPCIEQPILPTE 799          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: PEPR1_ARATH (Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 3.846e-22
Identity = 57/166 (34.34%), Postives = 95/166 (57.23%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVK-------QHAKLKISDVFDPELMKE--DPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQ 592
            P I+HRD+K  N+L+D + E  + DFG+ARL+   D+ +S +T+ GT GY+ PE         + DVYSYGVVLLEL+T KR  D +     ++V WV+        + +  ++ + DP L+ E  D ++  +++Q   +A +C    P  RPTM   + + ++++
Sbjct:  948 PPIVHRDIKPENILMDSDLEPHIGDFGLARLLD--DSTVSTATVTGTTGYIAPENAFKTVRGRESDVYSYGVVLLELVTRKRAVDKSFPESTDIVSWVRSALSSSNNNVEDMVTTIVDPILVDELLDSSLREQVMQVTELALSCTQQDPAMRPTMRDAVKLLEDVK 1111          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: CRK27_ARATH (Cysteine-rich receptor-like protein kinase 27 OS=Arabidopsis thaliana GN=CRK27 PE=2 SV=2)

HSP 1 Score: 105.531 bits (262), Expect = 3.846e-22
Identity = 64/158 (40.51%), Postives = 92/158 (58.23%), Query Frame = 2
Query:  128 IIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKR--------PTDSADFGDNNLVGWVKQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAM 577
            IIHRD+KSSNVLLDE    ++SDFGMAR     +T      + GT GY+ PEY    R S K DVYS+GV++LE++TGKR         TD   F   N   W++  +     ++ DP L++   + + E +Q L +A +C+ + P +RPTM  V++M
Sbjct:  454 IIHRDLKSSNVLLDEQMLPKISDFGMARQFDFDNTQAVTRRVVGTYGYMAPEYAMHGRFSVKTDVYSFGVLVLEIITGKRNSGLGLGEGTDLPTFAWQN---WIEGTS----MELIDPVLLQ--THDKKESMQCLEIALSCVQENPTKRPTMDSVVSM 602          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: RLK90_ARATH (Probable inactive receptor kinase RLK902 OS=Arabidopsis thaliana GN=RLK902 PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 5.023e-22
Identity = 70/179 (39.11%), Postives = 107/179 (59.78%), Query Frame = 2
Query:  107 SARGIPHI-------IHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDN-NLVGWVKQHAKLK-ISDVFDPELMKEDP--NIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLD 610
            +ARG+ ++        H ++KSSN+LL  + +ARVSDFG+A+L+SA  T  + +T     GY  PE     R S K DVYS+GVVLLELLTGK P++S    +  +L  WV   A+ +  ++VFD ELM  +   ++E E+ + L +   C +  P +RP M++V+   +E++  SG D
Sbjct:  472 AARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVSASSTTPNRAT-----GYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSVAREEWRNEVFDSELMSIETVVSVEEEMAEMLQLGIDCTEQHPDKRPVMVEVVRRIQELRQ-SGAD 644          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: CLV1_ARATH (Receptor protein kinase CLAVATA1 OS=Arabidopsis thaliana GN=CLV1 PE=1 SV=3)

HSP 1 Score: 105.145 bits (261), Expect = 5.023e-22
Identity = 59/159 (37.11%), Postives = 98/159 (61.64%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDN-NLVGWVKQHAKLKISDVFDPELMKE--DPNIE----IELLQHLHVASACLDDRPWRRPTMIQVMAM 577
            P I+HRD+KS+N+LLD +FEA V+DFG+A+ +        +S++AG+ GY+ PEY  + +   K DVYS+GVVLLEL+ GK+P    +FG+  ++V WV+ + + +I+   D  ++    DP +       ++    +A  C+++    RPTM +V+ M
Sbjct:  811 PLILHRDVKSNNILLDSDFEAHVADFGLAKFLVDGAASECMSSIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGKKPV--GEFGEGVDIVRWVR-NTEEEITQPSDAAIVVAIVDPRLTGYPLTSVIHVFKIAMMCVEEEAAARPTMREVVHM 966          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y4885_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3)

HSP 1 Score: 104.76 bits (260), Expect = 6.560e-22
Identity = 58/153 (37.91%), Postives = 88/153 (57.52%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMF 580
            P I+HRD+ S N+LL E++EA++SDFG A+L+    ++   S +AGT GYV PE   + + + K DVYS+GV+ LE++ G+ P D       + +      A L +  + D  L +  P I+ E+L+ L VA  CL   P  RPTM+ +   F
Sbjct:  899 PAIVHRDISSGNILLGEDYEAKISDFGTAKLLKPDSSNW--SAVAGTYGYVAPELAYAMKVTEKCDVYSFGVLTLEVIKGEHPGDLV-----STLSSSPPDATLSLKSISDHRLPEPTPEIKEEVLEILKVALLCLHSDPQARPTMLSISTAF 1044          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: PAM74_ARATH (Probable LRR receptor-like serine/threonine-protein kinase PAM74 OS=Arabidopsis thaliana GN=PAM74 PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 6.560e-22
Identity = 62/176 (35.23%), Postives = 104/176 (59.09%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMS-AMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVK-QHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKE------IQAGSGLDSQSTI 625
            P I+HRD+K++N+LLDE  +A+++DFG++R      +TH+S + +AGTPGY+ PEYYQ+ R   K DVYS+G+VLLE++T  +P        +++  WV  +  +  I+ + DP L  +  +  +   + L +A +C +     RP M QV    KE      ++    +DSQ+++
Sbjct:  698 PPIVHRDIKTTNILLDEQLKAKLADFGLSRSFPIGGETHIS-TVVAGTPGYLDPEYYQTTRLGEKSDVYSFGIVLLEIIT-NQPVIDQSRSKSHISQWVGFELTRGDITKIMDPNLNGDYESRSV--WRVLELAMSCANPSSVNRPNMSQVANELKECLVSENLRENMNMDSQNSL 869          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: CRK39_ARATH (Putative cysteine-rich receptor-like protein kinase 39 OS=Arabidopsis thaliana GN=CRK39 PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 6.560e-22
Identity = 58/149 (38.93%), Postives = 89/149 (59.73%), Query Frame = 2
Query:  128 IIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWV-KQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVM 571
            IIHRD+K+SN+LLD     +V+DFG ARL  + +T      +AGT GY+ PEY    + S K DVYS+GV+LLE+++G+R   +  F    L  +  K+  + K   + DP L+++  N  I+L+Q   +   C+ + P +RPTM  V+
Sbjct:  474 IIHRDLKASNILLDAEMNPKVADFGTARLFDSDETRAETKRIAGTRGYMAPEYLNHGQISAKSDVYSFGVMLLEMISGER---NNSFEGEGLAAFAWKRWVEGKPEIIIDPFLIEKPRNEIIKLIQ---IGLLCVQENPTKRPTMSSVI 616          
The following BLAST results are available for this feature:
BLAST of DC900011 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 291
Match NameE-valueIdentityDescription
CRK29_ARATH1.726e-2238.46Cysteine-rich receptor-like protein kinase 29 OS=A... [more]
ACCR4_ARATH2.255e-2240.00Serine/threonine-protein kinase-like protein CCR4 ... [more]
CRI4_MAIZE2.945e-2239.06Putative receptor protein kinase CRINKLY4 OS=Zea m... [more]
PEPR1_ARATH3.846e-2234.34Leucine-rich repeat receptor-like protein kinase P... [more]
CRK27_ARATH3.846e-2240.51Cysteine-rich receptor-like protein kinase 27 OS=A... [more]
RLK90_ARATH5.023e-2239.11Probable inactive receptor kinase RLK902 OS=Arabid... [more]
CLV1_ARATH5.023e-2237.11Receptor protein kinase CLAVATA1 OS=Arabidopsis th... [more]
Y4885_ARATH6.560e-2237.91Probable LRR receptor-like serine/threonine-protei... [more]
PAM74_ARATH6.560e-2235.23Probable LRR receptor-like serine/threonine-protei... [more]
CRK39_ARATH6.560e-2238.93Putative cysteine-rich receptor-like protein kinas... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900011 VSS Citrus sinensis cDNA clone VS27Q22 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900011 ID=DC900011|Name=DC900011|organism=Citrus sinensis|type=EST|length=850bp
GTTTTTTTTTTTTTTTTTTTAGAGAAAATAGAAATTTTTATATATTAAAA
GGGAAAGGAAGAAACAGACTAGAAAAAAAAAAACTCGAGACTAGCTCGTG
CCGAATTCGGCACGAGGCATCCCACACATTATCCACCGGGATATGAAATC
GAGCAATGTTCTGCTAGACGAAAACTTTGAGGCCAGAGTCTCAGATTTTG
GAATGGCAAGACTAATGAGTGCGATGGATACACATTTGAGTGTCAGTACG
CTAGCAGGCACACCCGGCTATGTCCCTCCCGAATACTATCAAAGCTTTAG
ATGTTCGACGAAAGGCGATGTTTACAGTTATGGTGTAGTTTTGCTCGAGT
TGCTAACGGGAAAAAGGCCAACAGATTCAGCAGATTTCGGTGACAATAAC
CTAGTTGGGTGGGTAAAGCAGCATGCGAAGCTGAAAATAAGCGATGTCTT
TGATCCAGAACTCATGAAAGAGGATCCAAACATCGAGATTGAGCTTCTTC
AACACTTGCATGTAGCGAGTGCTTGCCTGGATGATCGACCATGGAGGAGA
CCGACAATGATTCAGGTTATGGCAATGTTTAAAGAAATCCAAGCCGGTTC
AGGACTTGACTCGCAATCTACTATTGCCACTGATGAAGGAGGTTTCGGTA
CAGTCGAAATGGTAGAGATGAGCATCCAAGAAGCTCCAGAACTAAGCACC
AAGCCTTAGNCCATTCAATTTTCAGGACAAGCATTCTTTCAGTGCCCCAA
AATTTTCCCACTTGAAAACCAAAAAAGTTGCCTTTGGTATCTCTACCATT
TAGTGTATGTAATCTTTGTATCCCTTTTGAAAATTCTTGTTATTTATACA
back to top