DC900011

Overview
NameDC900011
Unique NameDC900011
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y5457_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g45780 OS=Arabidopsis thaliana GN=At5g45780 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 8.568e-22
Identity = 66/197 (33.50%), Postives = 115/197 (58.38%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTD--SADFGDNNLVGWVKQ-HAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEI--QAGSGLDSQSTIATDEGGFGTVEMVEMSIQEAPELS 697
            P IIHRD+K++N+LLDE+FEA V DFG+A+L+   D+H++ + + GT G++ PEY  + + S K DV+ +GV++LEL+TG +  D  +       ++ WV+   A+ + +++ D +L  E  ++ +E  + + +A  C    P  RP M QV+ + + +  Q   G ++++   +     G  E  +  I EA ELS
Sbjct:  420 PKIIHRDVKAANILLDESFEAIVGDFGLAKLLDQRDSHVT-TAVRGTIGHIAPEYLSTGQSSEKTDVFGFGVLILELITGHKMIDQGNGQVRKGMILSWVRTLKAEKRFAEMVDRDLKGEFDDLVLE--EVVELALLCTQPHPNLRPRMSQVLKVLEGLVEQCEGGYEARAPSVSRNYSNGHEE--QSFIIEAIELS 611          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: WAKLG_ARATH (Wall-associated receptor kinase-like 8 OS=Arabidopsis thaliana GN=WAKL8 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 8.568e-22
Identity = 69/175 (39.43%), Postives = 105/175 (60.00%), Query Frame = 2
Query:  104 NSARGIPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVG--WVKQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQA-GSGLDSQS 619
            +SA  IP I HRD+KS+N+LLDE   A+VSDFG++R ++  DTHL+ + + GT GYV PEY QS   + K DVYS+GV+L+ELLTG++P       +  ++G  +++     ++ ++ D  + KE+ + E E+L    +A  CL      RPTM  V      +Q+   G  SQ+
Sbjct:  504 HSAVSIP-IYHRDVKSTNILLDEKHRAKVSDFGISRSVAIDDTHLT-TIVQGTIGYVDPEYLQSNHFTGKSDVYSFGVLLIELLTGEKPVSLLRRQEVRMLGAYFLEAMRNDRLHEILDARI-KEECDRE-EVLAVAKLARRCLSLNSEHRPTMRDVFIELDRMQSKRKGTQSQA 674          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: NAK_ARATH (Probable serine/threonine-protein kinase NAK OS=Arabidopsis thaliana GN=NAK PE=2 SV=2)

HSP 1 Score: 104.375 bits (259), Expect = 8.568e-22
Identity = 62/162 (38.27%), Postives = 92/162 (56.79%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTD-SADFGDNNLVGWVKQHA--KLKISDVFDPELMKEDPNIEIELLQHLHVASA---CLDDRPWRRPTMIQVMAMFKEI 589
            P +I+RD K+SN+LLD N+ A++SDFG+AR     D     + + GT GY  PEY  +   S K DVYS+GVVLLELL+G+R  D +   G++NLV W + +   K ++  V DP L       +  L + L +A     C+      RPTM +++   +E+
Sbjct:  197 PQVIYRDFKASNILLDSNYNAKLSDFGLARDGPMGDNSHVSTRVMGTQGYAAPEYLATGHLSVKSDVYSFGVVLLELLSGRRAIDKNQPVGEHNLVDWARPYLTNKRRLLRVMDPRLQG-----QYSLTRALKIAVLALDCISIDAKSRPTMNEIVKTMEEL 353          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: ACR4_ARATH (Serine/threonine-protein kinase-like protein ACR4 OS=Arabidopsis thaliana GN=ACR4 PE=1 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 8.568e-22
Identity = 81/237 (34.18%), Postives = 125/237 (52.74%), Query Frame = 2
Query:  107 SARGI--------PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTL-AGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKL-KISDVFDPELMKEDPNIEIELLQHL-HVASACLDDRPWRRPTMIQVMAMFKE--IQAGSGLDSQSTIATDEGGFGTVEMVEMSIQEAPELSTKP*XIQFSGQAFFQCPKIFPLENQKS 778
            +ARGI        P +IHRD+KSSN+L+DE   ARV+DFG++ L+  +D+   ++ L AGT GY+ PEYY+    +TK DVYS+GV+LLE+L+G++  D   + + N+V W     K   I+ + DP L       EIE L+ +  VA  C+  R   RP+M +V    +    Q      S+  I   E   G+  M + S +   + S      +F G ++   P +   + +KS
Sbjct:  622 AARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLS-LLGPVDSGSPLAELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVLLLEILSGRKAID-MHYEEGNIVEWAVPLIKAGDINALLDPVLKHPS---EIEALKRIVSVACKCVRMRGKDRPSMDKVTTALERALAQLMGNPSSEQPILPTEVVLGSSRMHKKSWRIGSKRSGSE-NTEFRGGSWITFPSVTSSQRRKS 852          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y3868_ARATH (Probable inactive receptor kinase At3g08680 OS=Arabidopsis thaliana GN=At3g08680 PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.119e-21
Identity = 72/188 (38.30%), Postives = 108/188 (57.45%), Query Frame = 2
Query:  107 SARGIPHI--------IHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDN-NLVGWVKQHAKLK-ISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQ-AGSGLDSQSTIATDE 637
            +ARGI HI        +H ++KS NVLL +     VSDFG+A LMS      S S      GY  PE  ++ + + K DVYS+GV+LLE+LTGK    +    +  +L  WV+   + +   +VFD EL+K+  N+E E++Q L +A AC+   P  RP+M +V+ M +EI+ +GSG  S +  ++ E
Sbjct:  449 AARGISHIHSASGAKLLHGNIKSPNVLLTQELHVCVSDFGIAPLMSHHTLIPSRSL-----GYRAPEAIETRKHTQKSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNVEEEMVQMLQIAMACVSKHPDSRPSMEEVVNMMEEIRPSGSGPGSGNRASSPE 631          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: WAKLH_ARATH (Wall-associated receptor kinase-like 9 OS=Arabidopsis thaliana GN=WAKL9 PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.119e-21
Identity = 66/200 (33.00%), Postives = 112/200 (56.00%), Query Frame = 2
Query:  128 IIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVG--WVKQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSG-LDSQSTIATDEGG----FGTVEMVEMSIQEAPELSTKP 706
            I HRD+KS+N++LDE + A+VSDFG +R ++   THL+ + ++GT GY+ PEY+QS + + K DVYS+GVVL+EL+TG++        +N  +   ++    + K+ D+ D  +   D  +  ++     VA  CL+ +  +RP+M +V      I+   G +  Q  ++ +E G     G VE +  +   + E  T P
Sbjct:  569 IYHRDVKSTNIMLDEKYRAKVSDFGTSRTVTVDHTHLT-TVVSGTVGYMDPEYFQSSQFTDKSDVYSFGVVLVELITGEKSISFLRSQENRTLATYFILAMKENKLFDIIDARI--RDGCMLSQVTATAKVARKCLNLKGRKRPSMREVSMELDSIRMPCGDMQLQECVSENEEGEEQNKGLVEDIMRAESRSKEFVTAP 765          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: MEE39_ARATH (Probable LRR receptor-like serine/threonine-protein kinase MEE39 OS=Arabidopsis thaliana GN=MEE39 PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.119e-21
Identity = 62/160 (38.75%), Postives = 92/160 (57.50%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTL-AGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKL-KISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQA 595
            P ++HRD+KS+N+LLDE F+A+++DFG++R          VST+ AGT GY+ PEYY +   S K DVYS+G++LLE++T +R  D     + N+  WV    K    S + DP+L        +   + L VA +C +    +RP M QV+   KE  A
Sbjct:  685 PAMVHRDVKSTNILLDEEFKAKIADFGLSRSFQVGGDQSQVSTVVAGTLGYLDPEYYLTSELSEKSDVYSFGILLLEIITNQRVIDQTR-ENPNIAEWVTFVIKKGDTSQIVDPKLHGNYDTHSV--WRALEVAMSCANPSSVKRPNMSQVIINLKECLA 841          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y5830_ARATH (Probable inactive receptor kinase At5g58300 OS=Arabidopsis thaliana GN=At5g58300 PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.461e-21
Identity = 68/173 (39.31%), Postives = 104/173 (60.12%), Query Frame = 2
Query:  110 ARGIPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDN-NLVGWVKQHAKLK-ISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQST 622
            A G P   H ++KSSNV++ +  +A +SDFG+  LM+     + ++ + G  GY  PE  ++ + + K DVYS+GV++LE+LTGK P  S    D  +L  WV+   + +  S+VFD ELM+   NIE E++Q L +A AC+   P  RPTM  V+ M +EI+     DS++T
Sbjct:  475 AAGGPKFSHGNIKSSNVIMKQESDACISDFGLTPLMA-----VPIAPMRGA-GYRAPEVMETRKHTHKSDVYSFGVLILEMLTGKSPVQSPSRDDMVDLPRWVQSVVREEWTSEVFDIELMRFQ-NIEEEMVQMLQIAMACVAQVPEVRPTMDDVVRMIEEIRVS---DSETT 637          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: CRK33_ARATH (Putative cysteine-rich receptor-like protein kinase 33 OS=Arabidopsis thaliana GN=CRK33 PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.461e-21
Identity = 60/172 (34.88%), Postives = 98/172 (56.98%), Query Frame = 2
Query:   95 LVPNSARGIPH--------IIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTD--SADFGDNNLVGWVKQHAKL-KISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAM 577
            ++  +ARGI +        IIHRD+K+SN+LLD   E +V+DFGMAR+     +      + GT GY+ PEY    + S K DVYS+GV++LE+++GKR ++    D    NLV +  +H +     ++ D EL K   + E+   + +H+A  C+ + P +RP +  ++ M
Sbjct:  423 IIVGTARGILYLHHDSPLKIIHRDLKASNILLDAEMEPKVADFGMARIFRVDQSRADTRRVVGTHGYISPEYLMHGQFSVKSDVYSFGVLVLEIISGKRNSNFHETDESGKNLVTYAWRHWRNGSPLELVDSELEKNYQSNEV--FRCIHIALLCVQNDPEQRPNLSTIIMM 592          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: CRK17_ARATH (Cysteine-rich receptor-like protein kinase 17 OS=Arabidopsis thaliana GN=CRK17 PE=2 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 1.461e-21
Identity = 57/147 (38.78%), Postives = 92/147 (62.59%), Query Frame = 2
Query:  128 IIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTD--SADFGDNNLVGWV-KQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTM 559
            IIHRD+K+SN+LLD +   +++DFGMAR+     T  + + + GT GY+ PEY    + S K DVYS+GV++LE+++GK+ +     D   NNLV +V K      + ++ DP  +KED   + E+++++H+   C+ + P  RPTM
Sbjct:  480 IIHRDLKASNILLDADMNPKIADFGMARIFGVDQTVANTARVVGTFGYMSPEYVTHGQFSMKSDVYSFGVLILEIISGKKNSSFYQMDGLVNNLVTYVWKLWENKTMHELIDP-FIKEDCKSD-EVIRYVHIGLLCVQENPADRPTM 624          
The following BLAST results are available for this feature:
BLAST of DC900011 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 291
Match NameE-valueIdentityDescription
Y5457_ARATH8.568e-2233.50Probable LRR receptor-like serine/threonine-protei... [more]
WAKLG_ARATH8.568e-2239.43Wall-associated receptor kinase-like 8 OS=Arabidop... [more]
NAK_ARATH8.568e-2238.27Probable serine/threonine-protein kinase NAK OS=Ar... [more]
ACR4_ARATH8.568e-2234.18Serine/threonine-protein kinase-like protein ACR4 ... [more]
Y3868_ARATH1.119e-2138.30Probable inactive receptor kinase At3g08680 OS=Ara... [more]
WAKLH_ARATH1.119e-2133.00Wall-associated receptor kinase-like 9 OS=Arabidop... [more]
MEE39_ARATH1.119e-2138.75Probable LRR receptor-like serine/threonine-protei... [more]
Y5830_ARATH1.461e-2139.31Probable inactive receptor kinase At5g58300 OS=Ara... [more]
CRK33_ARATH1.461e-2134.88Putative cysteine-rich receptor-like protein kinas... [more]
CRK17_ARATH1.461e-2138.78Cysteine-rich receptor-like protein kinase 17 OS=A... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900011 VSS Citrus sinensis cDNA clone VS27Q22 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900011 ID=DC900011|Name=DC900011|organism=Citrus sinensis|type=EST|length=850bp
GTTTTTTTTTTTTTTTTTTTAGAGAAAATAGAAATTTTTATATATTAAAA
GGGAAAGGAAGAAACAGACTAGAAAAAAAAAAACTCGAGACTAGCTCGTG
CCGAATTCGGCACGAGGCATCCCACACATTATCCACCGGGATATGAAATC
GAGCAATGTTCTGCTAGACGAAAACTTTGAGGCCAGAGTCTCAGATTTTG
GAATGGCAAGACTAATGAGTGCGATGGATACACATTTGAGTGTCAGTACG
CTAGCAGGCACACCCGGCTATGTCCCTCCCGAATACTATCAAAGCTTTAG
ATGTTCGACGAAAGGCGATGTTTACAGTTATGGTGTAGTTTTGCTCGAGT
TGCTAACGGGAAAAAGGCCAACAGATTCAGCAGATTTCGGTGACAATAAC
CTAGTTGGGTGGGTAAAGCAGCATGCGAAGCTGAAAATAAGCGATGTCTT
TGATCCAGAACTCATGAAAGAGGATCCAAACATCGAGATTGAGCTTCTTC
AACACTTGCATGTAGCGAGTGCTTGCCTGGATGATCGACCATGGAGGAGA
CCGACAATGATTCAGGTTATGGCAATGTTTAAAGAAATCCAAGCCGGTTC
AGGACTTGACTCGCAATCTACTATTGCCACTGATGAAGGAGGTTTCGGTA
CAGTCGAAATGGTAGAGATGAGCATCCAAGAAGCTCCAGAACTAAGCACC
AAGCCTTAGNCCATTCAATTTTCAGGACAAGCATTCTTTCAGTGCCCCAA
AATTTTCCCACTTGAAAACCAAAAAAGTTGCCTTTGGTATCTCTACCATT
TAGTGTATGTAATCTTTGTATCCCTTTTGAAAATTCTTGTTATTTATACA
back to top