DC900011

Overview
NameDC900011
Unique NameDC900011
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: WAKLI_ARATH (Wall-associated receptor kinase-like 22 OS=Arabidopsis thaliana GN=WAKL22 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 4.252e-21
Identity = 63/166 (37.95%), Postives = 103/166 (62.05%), Query Frame = 2
Query:  104 NSARGIPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDN-NLVGWVKQHAKL-KISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQA 595
            +SA   P + HRD+K++N+LLDE + A+VSDFG +R ++   THL+ + +AGT GY+ PEY+Q+ + + K DVYS+GVVL+EL+TG++P       +N  LV    +  K  ++ D+ D  + KE   +E ++L    +A  CL  +  +RP M +V    + I++
Sbjct:  535 HSAASTP-VYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLT-TLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHFNEAMKQNRVLDIVDSRI-KEGCTLE-QVLAVAKLARRCLSLKGKKRPNMREVSVELERIRS 696          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y5596_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g59680 OS=Arabidopsis thaliana GN=At5g59680 PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 5.554e-21
Identity = 64/187 (34.22%), Postives = 111/187 (59.36%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAM-DTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKLKISDVFDPELMKEDPNIEI-ELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATDEGGFGTVEMVEMSI 676
            P ++HRD+K++N+LLDE+++A+++DFG++R      ++H+S + +AGTPGY+ PEYY + R S K DVYS+G+VLLE++T +   D  +   +++  WV   ++L   D+     +K + + +     + L +A +C D    RRPTM  V+   KE      L S+++      G  T+   E+S+
Sbjct:  699 PPMVHRDVKTTNILLDEHYKAKLADFGLSRSFPVGGESHVS-TVIAGTPGYLDPEYYHTSRLSEKSDVYSFGIVLLEMITNQAVID-RNRRKSHITQWV--GSELNGGDIAKIMDLKLNGDYDSRSAWRALELAMSCADPTSARRPTMSHVVIELKEC-----LVSENSRRNMSRGMDTLSSPEVSM 876          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y5182_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g51820 OS=Arabidopsis thaliana GN=At1g51820 PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 5.554e-21
Identity = 62/177 (35.03%), Postives = 108/177 (61.02%), Query Frame = 2
Query:   95 LVPNSARGI--------PHIIHRDMKSSNVLLDENFEARVSDFGMAR-LMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWV-KQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQA 595
            +V  SA+G+        P ++HRD+K++N+LL+E+FEA+++DFG++R  +   +TH+S + +AGTPGY+ PEY+++   + K DVYS+G++LLE++T +   D +     ++  WV     K  I  + DP L ++  +  +   + + +A +CL+    RRPTM QV+    E  A
Sbjct:  680 IVIESAQGLEYLHNGCKPPMVHRDVKTTNILLNEHFEAKLADFGLSRSFLIEGETHVS-TVVAGTPGYLDPEYHRTNWLTEKSDVYSFGILLLEIITNRHVIDQSR-EKPHIGEWVGVMLTKGDIQSIMDPSLNEDYDSGSV--WKAVELAMSCLNHSSARRPTMSQVVIELNECLA 852          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y5129_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g10290 OS=Arabidopsis thaliana GN=At5g10290 PE=1 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 5.554e-21
Identity = 62/166 (37.35%), Postives = 100/166 (60.24%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNN---LVGWVKQ-HAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGL 607
            P IIHRD+K++NVLLDE+FEA V DFG+A+L+    T+++ + + GT G++ PEY  + + S + DV+ YG++LLEL+TG+R  D +   + +   L+  VK+   + ++  + D  L  E    E+E++  + VA  C    P  RP M +V+ M +    G GL
Sbjct:  411 PKIIHRDVKAANVLLDEDFEAVVGDFGLAKLVDVRRTNVT-TQVRGTMGHIAPEYLSTGKSSERTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLEREKRLGAIVDKNLDGEYIKEEVEMM--IQVALLCTQGSPEDRPVMSEVVRMLE----GEGL 569          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: WAKLE_ARATH (Wall-associated receptor kinase-like 5 OS=Arabidopsis thaliana GN=WAKL5 PE=2 SV=2)

HSP 1 Score: 101.679 bits (252), Expect = 5.554e-21
Identity = 63/180 (35.00%), Postives = 110/180 (61.11%), Query Frame = 2
Query:  104 NSARGIPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTD--SADFGDNNLVGWVKQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATDE 637
            +SA   P I HRD+K++N+LLDE + A+VSDFG +R ++   THL+ + +AGT GY+ PEY+ S + + K DVYS+GVVL+EL+TG++P     ++ G      +++   + ++ D+ D  + KE+  ++ +L+    +A  CL  +  +RP M +     + I++ S  D ++ I  D+
Sbjct:  546 HSAASFP-IYHRDIKTTNILLDEKYGAKVSDFGTSRSVTIDQTHLT-TMVAGTFGYMDPEYFLSSQYTDKSDVYSFGVVLVELITGEKPLSRIRSEEGRGLATHFLEAMKENRVIDIIDIRI-KEESKLD-QLMAVAKLARKCLSRKGIKRPNMREASLELERIRS-SPEDLEAHIENDD 720          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: CRK40_ARATH (Cysteine-rich receptor-like protein kinase 40 OS=Arabidopsis thaliana GN=CRK40 PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 7.253e-21
Identity = 57/149 (38.26%), Postives = 87/149 (58.39%), Query Frame = 2
Query:  128 IIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWV-KQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVM 571
            IIHRD+K+SN+LLD     +V+DFG ARL  + +T      +AGT GY+ PEY    + S K DVYS+GV+LLE+++G+R   +  F    L  +  K+  + K   + DP L++   N  I+L+Q   +   C+ +   +RPTM  V+
Sbjct:  469 IIHRDLKASNILLDAEMNPKVADFGTARLFDSDETRAETKRIAGTRGYMAPEYLNHGQISAKSDVYSFGVMLLEMISGER---NNSFEGEGLAAFAWKRWVEGKPEIIIDPFLIENPRNEIIKLIQ---IGLLCVQENSTKRPTMSSVI 611          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y2267_ARATH (Probable inactive receptor kinase At2g26730 OS=Arabidopsis thaliana GN=At2g26730 PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 9.473e-21
Identity = 70/209 (33.49%), Postives = 111/209 (53.11%), Query Frame = 2
Query:  107 SARGIPHI------IHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDN--NLVGWVKQHAKLK-ISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATDEGGFGTVEMVEMSIQEAPELSTKP 706
            +ARG+ H+      +H ++K+SN+LL  N +  VSD+G+ +L S      + S      GY  PE  ++ + + K DVYS+GV+LLELLTGK P + A  G+   +L  WV    + +  ++VFD ELM+   NIE E++Q L +A AC+   P +RP M +V+ M +++      D     ++D+   G+           P  S  P
Sbjct:  458 AARGLAHLHVSAKLVHGNIKASNILLHPNQDTCVSDYGLNQLFS------NSSPPNRLAGYHAPEVLETRKVTFKSDVYSFGVLLLELLTGKSP-NQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYH-NIEEEMVQLLQIAMACVSTVPDQRPVMQEVLRMIEDVNRSETTDDGLRQSSDDPSKGSEGQTPPGESRTPPRSVTP 658          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: WAKLA_ARATH (Wall-associated receptor kinase-like 1 OS=Arabidopsis thaliana GN=WAKL1 PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 9.473e-21
Identity = 59/166 (35.54%), Postives = 104/166 (62.65%), Query Frame = 2
Query:  104 NSARGIPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTD--SADFGDNNLVGWVKQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQA 595
            +SA   P I HRD+K++N+LLDE + A+VSDFG +R ++   THL+ + +AGT GY+ PEY+ S + + K DVYS+GVVL+EL+TG++P     ++ G      +++   + ++ D+ D  + K++  +E +++    +A  CL+ +   RP M +V    + I++
Sbjct:  543 HSAASFP-IFHRDIKTTNILLDEKYRAKVSDFGTSRSVTLDQTHLT-TLVAGTFGYMDPEYFLSSQYTHKSDVYSFGVVLVELITGEKPLSRVRSEEGRGLATHFLEAMKENRVIDIIDIRI-KDESKLE-QVMAVAKLARKCLNRKGKNRPNMKEVSNELERIRS 704          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: APK2B_ARATH (Protein kinase 2B, chloroplastic OS=Arabidopsis thaliana GN=APK2B PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 9.473e-21
Identity = 66/184 (35.87%), Postives = 104/184 (56.52%), Query Frame = 2
Query:  128 IIHRDMKSSNVLLDENFEARVSDFGMARLMSAMD-THLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFG-DNNLVGWVKQHA--KLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQA---GSGL-DSQSTIATDEGGFGTV 655
            +I+RD K++N+LLD  F +++SDFG+A+     D TH+S   + GT GY  PEY  + R + K DVYS+GVVLLELL+G+R  D +  G + +LV W   +   K K+  + D  L  + P         L  A  CL+     RP M +V+A   ++++   G+G+ + Q+ I +  G  G++
Sbjct:  212 VIYRDFKAANILLDAEFNSKLSDFGLAKAGPTGDKTHVSTQVM-GTHGYAAPEYVATGRLTAKSDVYSFGVVLLELLSGRRAVDKSKVGMEQSLVDWATPYLGDKRKLFRIMDTRLGGQYPQKGAYTAASL--ALQCLNPDAKLRPKMSEVLAKLDQLESTKPGTGVGNRQAQIDSPRGSNGSI 392          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: WAKLN_ARATH (Wall-associated receptor kinase-like 18 OS=Arabidopsis thaliana GN=WAKL18 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.237e-20
Identity = 63/175 (36.00%), Postives = 101/175 (57.71%), Query Frame = 2
Query:  128 IIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKL-----KISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATDE 637
            I HRD+KS+N+LLDE + A+V+DFG +R ++   TH + + ++GT GYV PEYYQS + + K DVYS+GV+L EL+TG +P       +   +  + +H ++     +++D+ D  + + D   E +++    VA  CL  +  +RP M +V    + I   S  DSQ     DE
Sbjct:  575 IYHRDIKSTNILLDEKYRAKVADFGTSRSVTIDQTHWT-TVISGTVGYVDPEYYQSSQYTEKSDVYSFGVILAELITGDKPVIMVQ--NTQEIVALAEHFRVAMKEKRLTDIIDARI-RNDCKPE-QVMAVAKVAMKCLSSKGKKRPNMREVFTELERI-CTSPEDSQVHNRIDE 743          
The following BLAST results are available for this feature:
BLAST of DC900011 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 291
Match NameE-valueIdentityDescription
WAKLI_ARATH4.252e-2137.95Wall-associated receptor kinase-like 22 OS=Arabido... [more]
Y5596_ARATH5.554e-2134.22Probable LRR receptor-like serine/threonine-protei... [more]
Y5182_ARATH5.554e-2135.03Probable LRR receptor-like serine/threonine-protei... [more]
Y5129_ARATH5.554e-2137.35Probable LRR receptor-like serine/threonine-protei... [more]
WAKLE_ARATH5.554e-2135.00Wall-associated receptor kinase-like 5 OS=Arabidop... [more]
CRK40_ARATH7.253e-2138.26Cysteine-rich receptor-like protein kinase 40 OS=A... [more]
Y2267_ARATH9.473e-2133.49Probable inactive receptor kinase At2g26730 OS=Ara... [more]
WAKLA_ARATH9.473e-2135.54Wall-associated receptor kinase-like 1 OS=Arabidop... [more]
APK2B_ARATH9.473e-2135.87Protein kinase 2B, chloroplastic OS=Arabidopsis th... [more]
WAKLN_ARATH1.237e-2036.00Wall-associated receptor kinase-like 18 OS=Arabido... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900011 VSS Citrus sinensis cDNA clone VS27Q22 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900011 ID=DC900011|Name=DC900011|organism=Citrus sinensis|type=EST|length=850bp
GTTTTTTTTTTTTTTTTTTTAGAGAAAATAGAAATTTTTATATATTAAAA
GGGAAAGGAAGAAACAGACTAGAAAAAAAAAAACTCGAGACTAGCTCGTG
CCGAATTCGGCACGAGGCATCCCACACATTATCCACCGGGATATGAAATC
GAGCAATGTTCTGCTAGACGAAAACTTTGAGGCCAGAGTCTCAGATTTTG
GAATGGCAAGACTAATGAGTGCGATGGATACACATTTGAGTGTCAGTACG
CTAGCAGGCACACCCGGCTATGTCCCTCCCGAATACTATCAAAGCTTTAG
ATGTTCGACGAAAGGCGATGTTTACAGTTATGGTGTAGTTTTGCTCGAGT
TGCTAACGGGAAAAAGGCCAACAGATTCAGCAGATTTCGGTGACAATAAC
CTAGTTGGGTGGGTAAAGCAGCATGCGAAGCTGAAAATAAGCGATGTCTT
TGATCCAGAACTCATGAAAGAGGATCCAAACATCGAGATTGAGCTTCTTC
AACACTTGCATGTAGCGAGTGCTTGCCTGGATGATCGACCATGGAGGAGA
CCGACAATGATTCAGGTTATGGCAATGTTTAAAGAAATCCAAGCCGGTTC
AGGACTTGACTCGCAATCTACTATTGCCACTGATGAAGGAGGTTTCGGTA
CAGTCGAAATGGTAGAGATGAGCATCCAAGAAGCTCCAGAACTAAGCACC
AAGCCTTAGNCCATTCAATTTTCAGGACAAGCATTCTTTCAGTGCCCCAA
AATTTTCCCACTTGAAAACCAAAAAAGTTGCCTTTGGTATCTCTACCATT
TAGTGTATGTAATCTTTGTATCCCTTTTGAAAATTCTTGTTATTTATACA
back to top