DC900003

Overview
NameDC900003
Unique NameDC900003
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length545
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5630 contig Csv1_Contig5630:1..545. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: RLK_ARATH (Probable LRR receptor-like serine/threonine-protein kinase RLK OS=Arabidopsis thaliana GN=RLK PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.681e-14
Identity = 41/104 (39.42%), Postives = 61/104 (58.65%), Query Frame = 2
Query:  248 FDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALH-----GKPGM 544
            FDL +LLKASA +LG    G  YK VL  G  + V+R  +  +    EFQ  ++ +G++ H N++++ AYY+  +E LL+ D+   GSLA  LH     GKP +
Sbjct:  350 FDLQDLLKASAEILGSGCFGASYKAVLSSGQMMVVKRFKQMNNAGRDEFQEHMKRLGRLMHHNLLSIVAYYYRKEEKLLVCDFAERGSLAINLHSNQSLGKPSL 453          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y5977_ARATH (Probable leucine-rich repeat receptor-like protein kinase At5g49770 OS=Arabidopsis thaliana GN=At5g49770 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.195e-14
Identity = 41/105 (39.05%), Postives = 61/105 (58.10%), Query Frame = 2
Query:  245 AFDLDELLKAS-----AFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKPGM 544
            AF  +EL K +     A  +G  G G VYK  L +G  +A++R  +G  Q   EF+TE+E + ++ H N+V L  + +   E +L+Y+YIPNGSL   L GK G+
Sbjct:  621 AFTFEELSKCTNNFSDANDVGGGGYGQVYKGTLPNGQVIAIKRAQQGSMQGAFEFKTEIELLSRVHHKNVVKLLGFCFDQKEQMLVYEYIPNGSLRDGLSGKNGV 725          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: EXS_ARATH (Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.195e-14
Identity = 37/87 (42.53%), Postives = 55/87 (63.22%), Query Frame = 2
Query:  284 VLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKPGM 544
            ++G  G G VYK  L    T+AV++L E  +Q  +EF  E+E +GK++HPN+V+L  Y    +E LL+Y+Y+ NGSL   L  + GM
Sbjct:  922 IIGDGGFGTVYKACLPGEKTVAVKKLSEAKTQGNREFMAEMETLGKVKHPNLVSLLGYCSFSEEKLLVYEYMVNGSLDHWLRNQTGM 1008          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y4312_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g31250 OS=Arabidopsis thaliana GN=At4g31250 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 2.867e-14
Identity = 40/97 (41.24%), Postives = 58/97 (59.79%), Query Frame = 2
Query:  239 QVAFDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALH 529
            Q  F L ++L+ASA VLG  G G  YK  L  G  + V+R     +   +EF   ++ IG++ HPN++ L A+Y+  +E LL+ +YI NGSLA  LH
Sbjct:  356 QERFTLQDMLRASAEVLGSGGFGSSYKAALSSGRAVVVKRFRFMSNIGREEFYDHMKKIGRLSHPNLLPLIAFYYRKEEKLLVTNYISNGSLANLLH 452          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: CLV1_ARATH (Receptor protein kinase CLAVATA1 OS=Arabidopsis thaliana GN=CLV1 PE=1 SV=3)

HSP 1 Score: 78.1814 bits (191), Expect = 2.867e-14
Identity = 41/98 (41.84%), Postives = 61/98 (62.24%), Query Frame = 2
Query:  251 DLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRL-GEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKPG 541
            D+ E LK    ++GK G GIVY+  + + + +A++RL G G  +    F  E++ +G+IRH +IV L  Y  + D NLL+Y+Y+PNGSL   LHG  G
Sbjct:  687 DVLECLKEEN-IIGKGGAGIVYRGSMPNNVDVAIKRLVGRGTGRSDHGFTAEIQTLGRIRHRHIVRLLGYVANKDTNLLLYEYMPNGSLGELLHGSKG 783          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y1154_ARATH (Probable serine/threonine-protein kinase At1g01540 OS=Arabidopsis thaliana GN=At1g01540 PE=1 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 6.386e-14
Identity = 37/86 (43.02%), Postives = 53/86 (61.63%), Query Frame = 2
Query:  284 VLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKPG 541
            V+G+ G GIVY+ +L DG  +AV+ L     Q  KEF+ EVE IG++RH N+V L  Y       +L+YD++ NG+L   +HG  G
Sbjct:  159 VIGEGGYGIVYRGILTDGTKVAVKNLLNNRGQAEKEFKVEVEVIGRVRHKNLVRLLGYCVEGAYRMLVYDFVDNGNLEQWIHGDVG 244          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y4265_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.089e-13
Identity = 41/117 (35.04%), Postives = 71/117 (60.68%), Query Frame = 2
Query:  188 ETLSENVEQYDLVPLDTQVAFDLDELLK--ASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHG 532
            + L E ++ ++ V L  ++ F +D+++K   SA V+G    G+VY++ +  G +LAV+++     +    F +E++ +G IRH NIV L  +  + +  LL YDY+PNGSL+  LHG
Sbjct:  732 QLLGEEIDSWE-VTLYQKLDFSIDDIVKNLTSANVIGTGSSGVVYRITIPSGESLAVKKMWS--KEESGAFNSEIKTLGSIRHRNIVRLLGWCSNRNLKLLFYDYLPNGSLSSRLHG 845          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y5374_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g37450 OS=Arabidopsis thaliana GN=At5g37450 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.858e-13
Identity = 43/114 (37.72%), Postives = 65/114 (57.02%), Query Frame = 2
Query:  200 ENVEQYDLVPLDTQVAF--DLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGK 535
            E+V+ Y+   LD+  +   DL ++        G+ G G VYK  L  GL +AV+R  +G  Q  KEF TE+E + ++ H N+V+L  Y     E +L+Y+Y+PNGSL  AL  +
Sbjct:  614 ESVKGYNFTELDSATSSFSDLSQI--------GRGGYGKVYKGHLPGGLVVAVKRAEQGSLQGQKEFFTEIELLSRLHHRNLVSLLGYCDQKGEQMLVYEYMPNGSLQDALSAR 719          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: ERL1_ARATH (LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.858e-13
Identity = 38/84 (45.24%), Postives = 49/84 (58.33%), Query Frame = 2
Query:  281 FVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHG 532
            F++G      VYK  L+    +A++RL        +EF+TE+E IG IRH NIV+L  Y  S   NLL YDY+ NGSL   LHG
Sbjct:  652 FIIGYGASSTVYKCALKSSRPIAIKRLYNQYPHNLREFETELETIGSIRHRNIVSLHGYALSPTGNLLFYDYMENGSLWDLLHG 735          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: PSKR1_ARATH (Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4)

HSP 1 Score: 74.7146 bits (182), Expect = 3.170e-13
Identity = 39/100 (39.00%), Postives = 59/100 (59.00%), Query Frame = 2
Query:  230 LDTQVAFDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALH 529
            LD+  +FD        A ++G  G G+VYK  L DG  +A+++L     Q  +EF+ EVE + + +HPN+V LR + +  ++ LLIY Y+ NGSL   LH
Sbjct:  728 LDSTNSFD-------QANIIGCGGFGMVYKATLPDGKKVAIKKLSGDCGQIEREFEAEVETLSRAQHPNLVLLRGFCFYKNDRLLIYSYMENGSLDYWLH 820          
The following BLAST results are available for this feature:
BLAST of DC900003 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
RLK_ARATH1.681e-1439.42Probable LRR receptor-like serine/threonine-protei... [more]
Y5977_ARATH2.195e-1439.05Probable leucine-rich repeat receptor-like protein... [more]
EXS_ARATH2.195e-1442.53Leucine-rich repeat receptor protein kinase EXS OS... [more]
Y4312_ARATH2.867e-1441.24Probable LRR receptor-like serine/threonine-protei... [more]
CLV1_ARATH2.867e-1441.84Receptor protein kinase CLAVATA1 OS=Arabidopsis th... [more]
Y1154_ARATH6.386e-1443.02Probable serine/threonine-protein kinase At1g01540... [more]
Y4265_ARATH1.089e-1335.04Probable LRR receptor-like serine/threonine-protei... [more]
Y5374_ARATH1.858e-1337.72Probable LRR receptor-like serine/threonine-protei... [more]
ERL1_ARATH1.858e-1345.24LRR receptor-like serine/threonine-protein kinase ... [more]
PSKR1_ARATH3.170e-1339.00Phytosulfokine receptor 1 OS=Arabidopsis thaliana ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900003 VSS Citrus sinensis cDNA clone VS27Q14 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900003 ID=DC900003|Name=DC900003|organism=Citrus sinensis|type=EST|length=545bp
AGGGCTTAGTAAGAGTGCTATAGTAGCTATAATTGTGAGTGATGTAATTG
GAATTTGCCTTGTCGGGCTATTGTTCTCATATTGTTATTCAAGGGTTTGT
GGTTTTGGCGAGGGCAAGGATGAAAATTGTTATGCAAAAGGAGGTAAGGG
AAGANAAGAGTGCTTGTGCTTCAGGAAAGATGAATCAGAGACTCTCTCAG
AGAATGTTGAACAGTATGACCTTGTGCCGCTGGATACACAGGTGGCTTTT
GATTTGGATGAGCTGCTTAAGGCTTCAGCTTTTGTTCTTGGCAAGAGTGG
AATTGGGATTGTATACAAAGTTGTGCTTGAAGATGGACTTACTTTAGCCG
TGAGAAGGTTGGGTGAAGGCGGCTCTCAGAGGTTTAAGGAGTTCCAAACC
GAAGTAGAAGCAATTGGGAAGATAAGGCATCCAAACATTGTAACTCTCAG
AGCATATTACTGGTCTGTTGATGAGAACCTGCTCATATATGATTATATAC
CTAATGGAAGCCTAGCCNCTGCACTCCATGGGAAGCCAGGAATGG
back to top