DC900003

Overview
NameDC900003
Unique NameDC900003
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length545
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5630 contig Csv1_Contig5630:1..545. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: ACCR2_ARATH (Serine/threonine-protein kinase-like protein CCR2 OS=Arabidopsis thaliana GN=CCR2 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 4.140e-13
Identity = 49/136 (36.03%), Postives = 68/136 (50.00%), Query Frame = 2
Query:  161 CLCFRKDESETLSENVEQYDL-----VPLDTQVAFDLDELLKASAFV-----LGKSGIGIVYKVVLEDGLTLAVRRLGEGG--SQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHG 532
            C CF K+  E   + V    +     V L     F L EL  A+        LG+   G VYK VL DG+ +AV+R           + F++E+E + KIRH NIV L  Y   + E LL+Y+Y+P+G+L   LHG
Sbjct:  473 CFCFDKNSVEADPDPVPHQSVLLPTAVSLGETKIFRLSELKDATHGFKEFNELGRGSFGFVYKAVLSDGIHVAVKRANAATIIHSNNRGFESELEILCKIRHNNIVNLLGYCSEMGERLLVYEYMPHGTLHDHLHG 608          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y5344_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53440 OS=Arabidopsis thaliana GN=At1g53440 PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 9.222e-13
Identity = 45/114 (39.47%), Postives = 65/114 (57.02%), Query Frame = 2
Query:  209 EQYDLVPLDTQV-AFDLDELLKASAFV-----LGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHG 532
            E  +L  LD Q  +F L ++ +A+        +G+ G G VYK VL DG+T+AV++L     Q  +EF TE+  I  ++HPN+V L        E LL+Y+Y+ N SLA AL G
Sbjct:  641 ENEELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQGNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFG 754          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y5343_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53430 OS=Arabidopsis thaliana GN=At1g53430 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 9.222e-13
Identity = 45/114 (39.47%), Postives = 65/114 (57.02%), Query Frame = 2
Query:  209 EQYDLVPLDTQV-AFDLDELLKASAFV-----LGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHG 532
            E  +L  LD Q  +F L ++ +A+        +G+ G G VYK VL DG+T+AV++L     Q  +EF TE+  I  ++HPN+V L        E LL+Y+Y+ N SLA AL G
Sbjct:  643 ENEELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQGNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFG 756          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: ERL2_ARATH (LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 9.222e-13
Identity = 42/101 (41.58%), Postives = 57/101 (56.44%), Query Frame = 2
Query:  239 QVAFDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKPG 541
            +V  +LDE      +++G      VYK   +    +A++R+       F+EF+TE+E IG IRH NIV+L  Y  S   NLL YDY+ NGSL   LHG PG
Sbjct:  646 RVTENLDE-----KYIIGYGASSTVYKCTSKTSRPIAIKRIYNQYPSNFREFETELETIGSIRHRNIVSLHGYALSPFGNLLFYDYMENGSLWDLLHG-PG 740          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: BRI1_ARATH (Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 9.222e-13
Identity = 35/82 (42.68%), Postives = 51/82 (62.20%), Query Frame = 2
Query:  284 VLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALH 529
            ++G  G G VYK +L+DG  +A+++L     Q  +EF  E+E IGKI+H N+V L  Y    DE LL+Y+++  GSL   LH
Sbjct:  888 LIGSGGFGDVYKAILKDGSAVAIKKLIHVSGQGDREFMAEMETIGKIKHRNLVPLLGYCKVGDERLLVYEFMKYGSLEDVLH 969          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: TMKL1_ARATH (Putative kinase-like protein TMKL1 OS=Arabidopsis thaliana GN=TMKL1 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.204e-12
Identity = 41/93 (44.09%), Postives = 55/93 (59.14%), Query Frame = 2
Query:  254 LDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSV-DENLLIYDYIPNGSLAXALH 529
            LD++L A+  V+ K+  G VYK  L DG  +A+R L EG  +        +  +G+IRH N+V LRA+Y     E LLIYDY+PN SL   LH
Sbjct:  368 LDDVLNATGQVMEKTSYGTVYKAKLSDGGNIALRLLREGTCKDRSSCLPVIRQLGRIRHENLVPLRAFYQGKRGEKLLIYDYLPNISLHDLLH 460          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: PSKR2_ARATH (Phytosulfokine receptor 2 OS=Arabidopsis thaliana GN=PSKR2 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.204e-12
Identity = 40/97 (41.24%), Postives = 58/97 (59.79%), Query Frame = 2
Query:  254 LDELLKAS-----AFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALH 529
            ++ELLK++     A ++G  G G+VYK    DG   AV+RL     Q  +EFQ EVEA+ +  H N+V+L+ Y    ++ LLIY ++ NGSL   LH
Sbjct:  744 VEELLKSTNNFSQANIIGCGGFGLVYKANFPDGSKAAVKRLSGDCGQMEREFQAEVEALSRAEHKNLVSLQGYCKHGNDRLLIYSFMENGSLDYWLH 840          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: RPK2_ARATH (LRR receptor-like serine/threonine-protein kinase RPK2 OS=Arabidopsis thaliana GN=RPK2 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.573e-12
Identity = 33/100 (33.00%), Postives = 59/100 (59.00%), Query Frame = 2
Query:  230 LDTQVAFDLDELLKAS-----AFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSL 514
            +D  V    D +++A+     + ++G  G G  YK  +   + +A++RL  G  Q  ++F  E++ +G++RHPN+VTL  Y+ S  E  L+Y+Y+P G+L
Sbjct:  856 MDIGVPITFDNVVRATGNFNASNLIGNGGFGATYKAEISQDVVVAIKRLSIGRFQGVQQFHAEIKTLGRLRHPNLVTLIGYHASETEMFLVYNYLPGGNL 955          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: TMK1_ARATH (Probable receptor protein kinase TMK1 OS=Arabidopsis thaliana GN=TMK1 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.683e-12
Identity = 34/83 (40.96%), Postives = 53/83 (63.86%), Query Frame = 2
Query:  284 VLGKSGIGIVYKVVLEDGLTLAVRRLGEG--GSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXAL 526
            +LG  G G+VYK  L DG  +AV+R+  G    + F EF++E+  + K+RH ++VTL  Y    +E LL+Y+Y+P G+L+  L
Sbjct:  593 ILGSGGFGVVYKGELHDGTKIAVKRMENGVIAGKGFAEFKSEIAVLTKVRHRHLVTLLGYCLDGNEKLLVYEYMPQGTLSRHL 675          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: BRL3_ARATH (Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.683e-12
Identity = 36/84 (42.86%), Postives = 51/84 (60.71%), Query Frame = 2
Query:  284 VLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGK 535
            ++G  G G VYK  L DG  +A+++L +   Q  +EF  E+E IGKI+H N+V L  Y    +E LL+Y+Y+  GSL   LH K
Sbjct:  863 MIGSGGFGDVYKAKLADGSVVAIKKLIQVTGQGDREFMAEMETIGKIKHRNLVPLLGYCKIGEERLLVYEYMKYGSLETVLHEK 946          
The following BLAST results are available for this feature:
BLAST of DC900003 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
ACCR2_ARATH4.140e-1336.03Serine/threonine-protein kinase-like protein CCR2 ... [more]
Y5344_ARATH9.222e-1339.47Probable LRR receptor-like serine/threonine-protei... [more]
Y5343_ARATH9.222e-1339.47Probable LRR receptor-like serine/threonine-protei... [more]
ERL2_ARATH9.222e-1341.58LRR receptor-like serine/threonine-protein kinase ... [more]
BRI1_ARATH9.222e-1342.68Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidops... [more]
TMKL1_ARATH1.204e-1244.09Putative kinase-like protein TMKL1 OS=Arabidopsis ... [more]
PSKR2_ARATH1.204e-1241.24Phytosulfokine receptor 2 OS=Arabidopsis thaliana ... [more]
RPK2_ARATH1.573e-1233.00LRR receptor-like serine/threonine-protein kinase ... [more]
TMK1_ARATH2.683e-1240.96Probable receptor protein kinase TMK1 OS=Arabidops... [more]
BRL3_ARATH2.683e-1242.86Receptor-like protein kinase BRI1-like 3 OS=Arabid... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900003 VSS Citrus sinensis cDNA clone VS27Q14 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900003 ID=DC900003|Name=DC900003|organism=Citrus sinensis|type=EST|length=545bp
AGGGCTTAGTAAGAGTGCTATAGTAGCTATAATTGTGAGTGATGTAATTG
GAATTTGCCTTGTCGGGCTATTGTTCTCATATTGTTATTCAAGGGTTTGT
GGTTTTGGCGAGGGCAAGGATGAAAATTGTTATGCAAAAGGAGGTAAGGG
AAGANAAGAGTGCTTGTGCTTCAGGAAAGATGAATCAGAGACTCTCTCAG
AGAATGTTGAACAGTATGACCTTGTGCCGCTGGATACACAGGTGGCTTTT
GATTTGGATGAGCTGCTTAAGGCTTCAGCTTTTGTTCTTGGCAAGAGTGG
AATTGGGATTGTATACAAAGTTGTGCTTGAAGATGGACTTACTTTAGCCG
TGAGAAGGTTGGGTGAAGGCGGCTCTCAGAGGTTTAAGGAGTTCCAAACC
GAAGTAGAAGCAATTGGGAAGATAAGGCATCCAAACATTGTAACTCTCAG
AGCATATTACTGGTCTGTTGATGAGAACCTGCTCATATATGATTATATAC
CTAATGGAAGCCTAGCCNCTGCACTCCATGGGAAGCCAGGAATGG
back to top