DC900003

Overview
NameDC900003
Unique NameDC900003
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length545
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5630 contig Csv1_Contig5630:1..545. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: FEI1_ARATH (LRR receptor-like serine/threonine-protein kinase FEI 1 OS=Arabidopsis thaliana GN=FEI1 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.271e-11
Identity = 33/82 (40.24%), Postives = 50/82 (60.98%), Query Frame = 2
Query:  284 VLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALH 529
            ++G  G G VYK+ ++DG   A++R+ +      + F+ E+E +G I+H  +V LR Y  S    LL+YDY+P GSL  ALH
Sbjct:  311 IIGCGGFGTVYKLAMDDGKVFALKRILKLNEGFDRFFERELEILGSIKHRYLVNLRGYCNSPTSKLLLYDYLPGGSLDEALH 392          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: CRK33_ARATH (Putative cysteine-rich receptor-like protein kinase 33 OS=Arabidopsis thaliana GN=CRK33 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.271e-11
Identity = 30/77 (38.96%), Postives = 51/77 (66.23%), Query Frame = 2
Query:  284 VLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSL 514
            +LG+ G G V+K VL+DG  +AV+RL +  +Q  +EFQ E   + K++H N+V +  +    +E +L+Y+++PN SL
Sbjct:  326 MLGQGGFGEVFKGVLQDGSEIAVKRLSKESAQGVQEFQNETSLVAKLQHRNLVGVLGFCMEGEEKILVYEFVPNKSL 402          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: CRK25_ARATH (Cysteine-rich receptor-like protein kinase 25 OS=Arabidopsis thaliana GN=CRK25 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.271e-11
Identity = 31/76 (40.79%), Postives = 49/76 (64.47%), Query Frame = 2
Query:  287 LGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSL 514
            LG  G G VYK  L  G T+A++RL +G +Q  +EF+ EV+ + K++H N+  L  Y    +E +L+Y+++PN SL
Sbjct:  353 LGHGGFGEVYKGQLITGETVAIKRLSQGSTQGAEEFKNEVDVVAKLQHRNLAKLLGYCLDGEEKILVYEFVPNKSL 428          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: ACCR1_ARATH (Serine/threonine-protein kinase-like protein CCR1 OS=Arabidopsis thaliana GN=CCR1 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.271e-11
Identity = 50/130 (38.46%), Postives = 66/130 (50.77%), Query Frame = 2
Query:  167 CFRKDESETLS--ENVEQYDLVPLDTQVAFDLDELLKASAFV-----LGKSGIGIVYKVVLEDGLTLAVRRLGEGG--SQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALH 529
            C  K + +T    ENV     V    QV F L EL  A+        LG+   G VYK VL DG  +AV+R           +EF+TE+E +  IRH NIV L  Y   + E LL+Y+Y+P+G+L   LH
Sbjct:  480 CIGKPDLDTDQPLENVSPAPSVTPFAQV-FRLSELKDATNGFKEFNELGRGSYGFVYKAVLADGRQVAVKRANAATIIHTNTREFETELEILCNIRHCNIVNLLGYSTEMGERLLVYEYMPHGTLHDHLH 608          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y5900_ARATH (Putative receptor-like protein kinase At5g39000 OS=Arabidopsis thaliana GN=At5g39000 PE=3 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 2.967e-11
Identity = 41/114 (35.96%), Postives = 66/114 (57.89%), Query Frame = 2
Query:  191 TLSENVEQYDLVPLDTQVAFDLDELLKAS-----AFVLGKSGIGIVYKVVLEDGLTL-AVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSL 514
            T S N +    +P D    F + E+  A+       ++G  G G VYK  ++ G TL AV+RL    +Q  KEF+TE+E + K+RH ++V+L  Y    +E +L+Y+Y+P+G+L
Sbjct:  487 TDSTNTKPAKSLPADLCRRFSIFEIKSATNDFEDKLIIGVGGFGSVYKGQIDGGATLVAVKRLEITSNQGAKEFETELEMLSKLRHVHLVSLIGYCDEDNEMVLVYEYMPHGTL 600          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y1570_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g05700 OS=Arabidopsis thaliana GN=At1g05700 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 2.967e-11
Identity = 36/84 (42.86%), Postives = 52/84 (61.90%), Query Frame = 2
Query:  284 VLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGK 535
            VLGK G G VY     D L +AV+ L E  +Q FKEF++EVE + ++ H N+  L  Y+   D+  LIY+++ NG++A  L GK
Sbjct:  575 VLGKGGFGTVYHGFY-DNLQVAVKLLSETSAQGFKEFRSEVEVLVRVHHVNLTALIGYFHEGDQMGLIYEFMANGNMADHLAGK 657          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: SERK5_ARATH (Somatic embryogenesis receptor kinase 5 OS=Arabidopsis thaliana GN=SERK5 PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 2.967e-11
Identity = 49/128 (38.28%), Postives = 67/128 (52.34%), Query Frame = 2
Query:  173 RKDESETLSENVEQYDLVPLDTQVAFDLDELLKASAF-----VLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFK-EFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKP 538
            RK +   L    E+   V L     F L ELL A+       VLGK   GI+YK  L D   +AV+RL E  ++  + +FQTEVE I    H N++ LR +  +  E LL+Y Y+ NGS+A  L  +P
Sbjct:  238 RKLQGHFLDVPAEEDPEVYLGQFKRFSLRELLVATEKFSKRNVLGKGRFGILYKGRLADDTLVAVKRLNEERTKGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERP 365          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: RCH2_ARATH (Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 2.967e-11
Identity = 45/136 (33.09%), Postives = 72/136 (52.94%), Query Frame = 2
Query:  173 RKDESETLSENVEQY--DLVPLDTQVAFDLDELLKA--SAFVLGKSGIGIVYKVVLEDGLTLAVRRL-----GEGGSQRFKE----FQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKPG 541
            R  ++E  SE  E Y     P   ++ F +D++++      V+GK   G+VY+  +++G  +AV++L       G  ++ K     F  EV+ +G IRH NIV      W+ +  LL+YDY+PNGSL   LH + G
Sbjct:  751 RNIDNERDSELGETYKWQFTPFQ-KLNFSVDQIIRCLVEPNVIGKGCSGVVYRADVDNGEVIAVKKLWPAMVNGGHDEKTKNVRDSFSAEVKTLGTIRHKNIVRFLGCCWNRNTRLLMYDYMPNGSLGSLLHERRG 885          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: CRK20_ARATH (Putative cysteine-rich receptor-like protein kinase 20 OS=Arabidopsis thaliana GN=CRK20 PE=2 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 2.967e-11
Identity = 39/121 (32.23%), Postives = 63/121 (52.07%), Query Frame = 2
Query:  173 RKDESETLSENVEQYDLVPLDT--QVAFDLDELLKASAFVL-----GKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSL 514
            ++ E+E      E  D   + T   + FD   ++ A+   L     G+ G G VYK     G+ +AV+RL +   Q  KEF+ EV  + K++H N+V L  Y    +E +L+Y+++PN SL
Sbjct:  305 KRKETEVTEPPAETTDGDDITTAGSLQFDFKAIVAATDIFLPINKLGQGGFGEVYKGTFPSGVQVAVKRLSKNSGQGEKEFENEVVVVAKLQHRNLVKLLGYCLEGEEKILVYEFVPNKSL 425          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y5005_ARATH (Probable receptor-like protein kinase At5g20050 OS=Arabidopsis thaliana GN=At5g20050 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 3.874e-11
Identity = 39/91 (42.86%), Postives = 55/91 (60.44%), Query Frame = 2
Query:  251 DLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDEN---LLIYDYIPNGSL 514
            DL+E       ++GK G G V+K VL+DG  +AV+R+ EG  +  +EF++EV AI  ++H N+V L  Y  S   N    L+YDYI N SL
Sbjct:   97 DLEEATDGFRSLIGKGGSGSVFKGVLKDGSQVAVKRI-EGEEKGEREFRSEVAAIASVQHKNLVRLYGYSSSTSANRPRFLVYDYIVNSSL 186          
The following BLAST results are available for this feature:
BLAST of DC900003 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
FEI1_ARATH2.271e-1140.24LRR receptor-like serine/threonine-protein kinase ... [more]
CRK33_ARATH2.271e-1138.96Putative cysteine-rich receptor-like protein kinas... [more]
CRK25_ARATH2.271e-1140.79Cysteine-rich receptor-like protein kinase 25 OS=A... [more]
ACCR1_ARATH2.271e-1138.46Serine/threonine-protein kinase-like protein CCR1 ... [more]
Y5900_ARATH2.967e-1135.96Putative receptor-like protein kinase At5g39000 OS... [more]
Y1570_ARATH2.967e-1142.86Probable LRR receptor-like serine/threonine-protei... [more]
SERK5_ARATH2.967e-1138.28Somatic embryogenesis receptor kinase 5 OS=Arabido... [more]
RCH2_ARATH2.967e-1133.09Receptor-like protein kinase 2 OS=Arabidopsis thal... [more]
CRK20_ARATH2.967e-1132.23Putative cysteine-rich receptor-like protein kinas... [more]
Y5005_ARATH3.874e-1142.86Probable receptor-like protein kinase At5g20050 OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900003 VSS Citrus sinensis cDNA clone VS27Q14 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900003 ID=DC900003|Name=DC900003|organism=Citrus sinensis|type=EST|length=545bp
AGGGCTTAGTAAGAGTGCTATAGTAGCTATAATTGTGAGTGATGTAATTG
GAATTTGCCTTGTCGGGCTATTGTTCTCATATTGTTATTCAAGGGTTTGT
GGTTTTGGCGAGGGCAAGGATGAAAATTGTTATGCAAAAGGAGGTAAGGG
AAGANAAGAGTGCTTGTGCTTCAGGAAAGATGAATCAGAGACTCTCTCAG
AGAATGTTGAACAGTATGACCTTGTGCCGCTGGATACACAGGTGGCTTTT
GATTTGGATGAGCTGCTTAAGGCTTCAGCTTTTGTTCTTGGCAAGAGTGG
AATTGGGATTGTATACAAAGTTGTGCTTGAAGATGGACTTACTTTAGCCG
TGAGAAGGTTGGGTGAAGGCGGCTCTCAGAGGTTTAAGGAGTTCCAAACC
GAAGTAGAAGCAATTGGGAAGATAAGGCATCCAAACATTGTAACTCTCAG
AGCATATTACTGGTCTGTTGATGAGAACCTGCTCATATATGATTATATAC
CTAATGGAAGCCTAGCCNCTGCACTCCATGGGAAGCCAGGAATGG
back to top