DC900003

Overview
NameDC900003
Unique NameDC900003
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length545
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5630 contig Csv1_Contig5630:1..545. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: HSL2_ARATH (LRR receptor-like serine/threonine-protein kinase HSL2 OS=Arabidopsis thaliana GN=HSL2 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 3.874e-11
Identity = 36/87 (41.38%), Postives = 55/87 (63.22%), Query Frame = 2
Query:  284 VLGKSGIGIVYKVVLEDGLTLAVRRL-GEGGSQRFKE--FQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGK 535
            ++G  G G+VY+V L+ G TLAV++L GE G +   E  F++EVE +G++RH NIV L       +   L+Y+++ NGSL   LH +
Sbjct:  691 IIGSGGSGLVYRVKLKSGQTLAVKKLWGETGQKTESESVFRSEVETLGRVRHGNIVKLLMCCNGEEFRFLVYEFMENGSLGDVLHSE 777          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: FEI2_ARATH (LRR receptor-like serine/threonine-protein kinase FEI 2 OS=Arabidopsis thaliana GN=FEI2 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 3.874e-11
Identity = 33/82 (40.24%), Postives = 50/82 (60.98%), Query Frame = 2
Query:  284 VLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALH 529
            ++G  G G VYK+ ++DG   A++R+ +      + F+ E+E +G I+H  +V LR Y  S    LL+YDY+P GSL  ALH
Sbjct:  309 IIGCGGFGTVYKLSMDDGNVFALKRIVKLNEGFDRFFERELEILGSIKHRYLVNLRGYCNSPTSKLLLYDYLPGGSLDEALH 390          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: CRK39_ARATH (Putative cysteine-rich receptor-like protein kinase 39 OS=Arabidopsis thaliana GN=CRK39 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 3.874e-11
Identity = 40/119 (33.61%), Postives = 63/119 (52.94%), Query Frame = 2
Query:  173 RKDESETLSENVEQYDLVPLDTQVAFDLDELLKA-----SAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSL 514
            RK+    ++    +Y        + FDL  +L A     S   LG+ G G VYK  L +G  +AV+RL +G  Q   EF+ EV  + +++H N+V L  +    DE +L+Y+++PN SL
Sbjct:  316 RKESYNKINVGSAEYSDSDGQFMLRFDLGMVLAATDEFSSENTLGQGGFGTVYKGTLLNGQEVAVKRLTKGSGQGDIEFKNEVSLLTRLQHRNLVKLLGFCNEGDEQILVYEFVPNSSL 434          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y5457_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g45780 OS=Arabidopsis thaliana GN=At5g45780 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 5.060e-11
Identity = 35/86 (40.70%), Postives = 52/86 (60.47%), Query Frame = 2
Query:  284 VLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKPG 541
            +LG+ G G+VYK  L +G  +AV+RL +       +FQTEVE IG   H N++ L  +  + +E +L+Y Y+PNGS+A  L    G
Sbjct:  305 ILGQGGFGMVYKGYLPNGTVVAVKRLKDPIYTGEVQFQTEVEMIGLAVHRNLLRLFGFCMTPEERMLVYPYMPNGSVADRLRDNYG 390          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y5389_ARATH (Probable receptor-like protein kinase At5g38990 OS=Arabidopsis thaliana GN=At5g38990 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 5.060e-11
Identity = 41/114 (35.96%), Postives = 65/114 (57.02%), Query Frame = 2
Query:  191 TLSENVEQYDLVPLDTQVAFDLDELLKAS-----AFVLGKSGIGIVYKVVLEDGLTL-AVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSL 514
            T S N +    +P D    F + E+  A+       ++G  G G VYK  ++ G TL AV+RL    +Q  KEF TE+E + K+RH ++V+L  Y    +E +L+Y+Y+P+G+L
Sbjct:  494 TGSTNTKSASSLPSDLCRRFSIYEIKSATNDFEEKLIIGVGGFGSVYKGRIDGGATLVAVKRLEITSNQGAKEFDTELEMLSKLRHVHLVSLIGYCDDDNEMVLVYEYMPHGTL 607          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: SERK1_ARATH (Somatic embryogenesis receptor kinase 1 OS=Arabidopsis thaliana GN=SERK1 PE=1 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 5.060e-11
Identity = 45/106 (42.45%), Postives = 58/106 (54.72%), Query Frame = 2
Query:  248 FDLDELLKAS-----AFVLGKSGIGIVYKVVLEDGLTLAVRRLGE----GGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKP 538
            F L EL  AS       +LG+ G G VYK  L DG  +AV+RL E    GG     +FQTEVE I    H N++ LR +  +  E LL+Y Y+ NGS+A  L  +P
Sbjct:  290 FSLRELQVASDGFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERTPGGEL---QFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERP 392          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: CRK37_ARATH (Cysteine-rich receptor-like protein kinase 37 OS=Arabidopsis thaliana GN=CRK37 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 5.060e-11
Identity = 39/120 (32.50%), Postives = 68/120 (56.67%), Query Frame = 2
Query:  170 FRKDESETLSENVEQYDLVPLDTQVAFDLDELLKASAFV-----LGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSL 514
            +++ +S T+  +V  +D     + + FDL  ++ A+        LG+ G G VYK +L  G  +AV+RL +G  Q   EF+ EV  + +++H N+V L  +    DE +L+Y+++PN SL
Sbjct:  309 WKRKQSHTIINDV--FDSNNGQSMLRFDLRMIVTATNNFSLENKLGQGGFGSVYKGILPSGQEIAVKRLRKGSGQGGMEFKNEVLLLTRLQHRNLVKLLGFCNEKDEEILVYEFVPNSSL 426          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: CRK32_ARATH (Putative cysteine-rich receptor-like protein kinase 32 OS=Arabidopsis thaliana GN=CRK32 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 5.060e-11
Identity = 33/82 (40.24%), Postives = 49/82 (59.76%), Query Frame = 2
Query:  287 LGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHG 532
            LGK G G VYK +L +   +AV+RL     Q  +EF+ EV  + K++H N+V L  +    DE +L+Y+++PN SL   L G
Sbjct:  327 LGKGGFGEVYKGMLPNETEVAVKRLSSNSGQGTQEFKNEVVIVAKLQHKNLVRLLGFCLERDEQILVYEFVPNKSLNYFLFG 408          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y1839_ARATH (Probable serine/threonine-protein kinase At1g18390 OS=Arabidopsis thaliana GN=At1g18390 PE=1 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 6.609e-11
Identity = 35/83 (42.17%), Postives = 52/83 (62.65%), Query Frame = 2
Query:  287 LGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDEN-LLIYDYIPNGSLAXALHG 532
            LG  G G VY   L+DG ++AV+RL +   +R ++F+ EVE +  +RHPN+V L         + LL+Y+Y+ NG+LA  LHG
Sbjct:  350 LGDGGFGTVYYGKLKDGRSVAVKRLYDNNFKRAEQFRNEVEILTGLRHPNLVALFGCSSKQSRDLLLVYEYVANGTLADHLHG 432          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: SERK2_ARATH (Somatic embryogenesis receptor kinase 2 OS=Arabidopsis thaliana GN=SERK2 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 6.609e-11
Identity = 39/89 (43.82%), Postives = 52/89 (58.43%), Query Frame = 2
Query:  284 VLGKSGIGIVYKVVLEDGLTLAVRRLGE----GGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKP 538
            +LG+ G G VYK  L DG  +AV+RL E    GG     +FQTEVE I    H N++ LR +  +  E LL+Y Y+ NGS+A  L  +P
Sbjct:  310 ILGRGGFGKVYKGRLADGTLVAVKRLKEERTPGGEL---QFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERP 395          
The following BLAST results are available for this feature:
BLAST of DC900003 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
HSL2_ARATH3.874e-1141.38LRR receptor-like serine/threonine-protein kinase ... [more]
FEI2_ARATH3.874e-1140.24LRR receptor-like serine/threonine-protein kinase ... [more]
CRK39_ARATH3.874e-1133.61Putative cysteine-rich receptor-like protein kinas... [more]
Y5457_ARATH5.060e-1140.70Probable LRR receptor-like serine/threonine-protei... [more]
Y5389_ARATH5.060e-1135.96Probable receptor-like protein kinase At5g38990 OS... [more]
SERK1_ARATH5.060e-1142.45Somatic embryogenesis receptor kinase 1 OS=Arabido... [more]
CRK37_ARATH5.060e-1132.50Cysteine-rich receptor-like protein kinase 37 OS=A... [more]
CRK32_ARATH5.060e-1140.24Putative cysteine-rich receptor-like protein kinas... [more]
Y1839_ARATH6.609e-1142.17Probable serine/threonine-protein kinase At1g18390... [more]
SERK2_ARATH6.609e-1143.82Somatic embryogenesis receptor kinase 2 OS=Arabido... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900003 VSS Citrus sinensis cDNA clone VS27Q14 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900003 ID=DC900003|Name=DC900003|organism=Citrus sinensis|type=EST|length=545bp
AGGGCTTAGTAAGAGTGCTATAGTAGCTATAATTGTGAGTGATGTAATTG
GAATTTGCCTTGTCGGGCTATTGTTCTCATATTGTTATTCAAGGGTTTGT
GGTTTTGGCGAGGGCAAGGATGAAAATTGTTATGCAAAAGGAGGTAAGGG
AAGANAAGAGTGCTTGTGCTTCAGGAAAGATGAATCAGAGACTCTCTCAG
AGAATGTTGAACAGTATGACCTTGTGCCGCTGGATACACAGGTGGCTTTT
GATTTGGATGAGCTGCTTAAGGCTTCAGCTTTTGTTCTTGGCAAGAGTGG
AATTGGGATTGTATACAAAGTTGTGCTTGAAGATGGACTTACTTTAGCCG
TGAGAAGGTTGGGTGAAGGCGGCTCTCAGAGGTTTAAGGAGTTCCAAACC
GAAGTAGAAGCAATTGGGAAGATAAGGCATCCAAACATTGTAACTCTCAG
AGCATATTACTGGTCTGTTGATGAGAACCTGCTCATATATGATTATATAC
CTAATGGAAGCCTAGCCNCTGCACTCCATGGGAAGCCAGGAATGG
back to top