DC900003

Overview
NameDC900003
Unique NameDC900003
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length545
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5630 contig Csv1_Contig5630:1..545. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y2317_ARATH (Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 8.631e-11
Identity = 39/109 (35.78%), Postives = 63/109 (57.80%), Query Frame = 2
Query:  248 FDLDELLKAS-----AFVLGKSGIGIVYKVVLEDGLTLAVRRLG---EGGSQRFKE----FQTEVEAIGKIRHPNIVTLRA--YYWSVDENLLIYDYIPNGSLAXALHG 532
            F + ++L+A+     ++++G+   G VYK V+  G T+AV++L    EG +         F+ E+  +GKIRH NIV L +  Y+   + NLL+Y+Y+  GSL   LHG
Sbjct:  807 FTVKDILEATKGFHDSYIVGRGACGTVYKAVMPSGKTIAVKKLESNREGNNNNSNNTDNSFRAEILTLGKIRHRNIVRLYSFCYHQGSNSNLLLYEYMSRGSLGELLHG 915          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y1561_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g56130 OS=Arabidopsis thaliana GN=At1g56130 PE=1 SV=2)

HSP 1 Score: 66.6254 bits (161), Expect = 8.631e-11
Identity = 43/119 (36.13%), Postives = 61/119 (51.26%), Query Frame = 2
Query:  179 DESETLSENVEQYDLVPLDTQVAF-DLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHG 532
            D+ E L  +V+ Y     + + A  D D   K     LG+ G G VYK  L DG  +AV+ L  G  Q   +F  E+ AI  + H N+V L    +  +  +L+Y+Y+PNGSL  AL G
Sbjct:  668 DDEELLGMDVKPYIFTYSELKSATQDFDPSNK-----LGEGGFGPVYKGNLNDGRVVAVKLLSVGSRQGKGQFVAEIVAISSVLHRNLVKLYGCCFEGEHRMLVYEYLPNGSLDQALFG 781          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: RLK7_ARATH (Receptor-like protein kinase At5g59670 OS=Arabidopsis thaliana GN=At5g59670 PE=1 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 8.631e-11
Identity = 33/86 (38.37%), Postives = 51/86 (59.30%), Query Frame = 2
Query:  284 VLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKPG 541
            VLGK G G+VY   ++    +AV+ L +  +Q  KEF+ EV+ + ++ H N+V+L  Y    D   L+Y+++PNG L   L GK G
Sbjct:  569 VLGKGGFGMVYHGTVKGSEQVAVKVLSQSSTQGSKEFKAEVDLLLRVHHTNLVSLVGYCCEGDYLALVYEFLPNGDLKQHLSGKGG 654          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: RCH1_ARATH (LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 8.631e-11
Identity = 43/136 (31.62%), Postives = 64/136 (47.06%), Query Frame = 2
Query:  173 RKDESETLSENVEQYDLVPLDTQVAFDLDELLKA--SAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKE----------FQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKPGM 544
            R D      EN+  +   P   ++ F ++ +LK      V+GK   GIVYK  + +   +AV++L         E          F  EV+ +G IRH NIV      W+ +  LL+YDY+ NGSL   LH + G+
Sbjct:  752 RDDNDSETGENLWTWQFTPFQ-KLNFTVEHVLKCLVEGNVIGKGCSGIVYKAEMPNREVIAVKKLWPVTVPNLNEKTKSSGVRDSFSAEVKTLGSIRHKNIVRFLGCCWNKNTRLLMYDYMSNGSLGSLLHERSGV 886          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: CRK10_ARATH (Cysteine-rich receptor-like protein kinase 10 OS=Arabidopsis thaliana GN=CRK10 PE=1 SV=2)

HSP 1 Score: 66.6254 bits (161), Expect = 8.631e-11
Identity = 31/76 (40.79%), Postives = 47/76 (61.84%), Query Frame = 2
Query:  287 LGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSL 514
            +G+ G G VYK  L DG  +AV+RL +   Q   EF+ EV  + K++H N+V L  +    +E +L+Y+Y+PN SL
Sbjct:  343 IGQGGFGEVYKGTLSDGTEVAVKRLSKSSGQGEVEFKNEVVLVAKLQHRNLVRLLGFCLDGEERVLVYEYVPNKSL 418          
The following BLAST results are available for this feature:
BLAST of DC900003 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
Y2317_ARATH8.631e-1135.78Probable leucine-rich repeat receptor-like protein... [more]
Y1561_ARATH8.631e-1136.13Probable LRR receptor-like serine/threonine-protei... [more]
RLK7_ARATH8.631e-1138.37Receptor-like protein kinase At5g59670 OS=Arabidop... [more]
RCH1_ARATH8.631e-1131.62LRR receptor-like serine/threonine-protein kinase ... [more]
CRK10_ARATH8.631e-1140.79Cysteine-rich receptor-like protein kinase 10 OS=A... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900003 VSS Citrus sinensis cDNA clone VS27Q14 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900003 ID=DC900003|Name=DC900003|organism=Citrus sinensis|type=EST|length=545bp
AGGGCTTAGTAAGAGTGCTATAGTAGCTATAATTGTGAGTGATGTAATTG
GAATTTGCCTTGTCGGGCTATTGTTCTCATATTGTTATTCAAGGGTTTGT
GGTTTTGGCGAGGGCAAGGATGAAAATTGTTATGCAAAAGGAGGTAAGGG
AAGANAAGAGTGCTTGTGCTTCAGGAAAGATGAATCAGAGACTCTCTCAG
AGAATGTTGAACAGTATGACCTTGTGCCGCTGGATACACAGGTGGCTTTT
GATTTGGATGAGCTGCTTAAGGCTTCAGCTTTTGTTCTTGGCAAGAGTGG
AATTGGGATTGTATACAAAGTTGTGCTTGAAGATGGACTTACTTTAGCCG
TGAGAAGGTTGGGTGAAGGCGGCTCTCAGAGGTTTAAGGAGTTCCAAACC
GAAGTAGAAGCAATTGGGAAGATAAGGCATCCAAACATTGTAACTCTCAG
AGCATATTACTGGTCTGTTGATGAGAACCTGCTCATATATGATTATATAC
CTAATGGAAGCCTAGCCNCTGCACTCCATGGGAAGCCAGGAATGG
back to top