DC899998

Overview
NameDC899998
Unique NameDC899998
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length870
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2224 contig Csv1_Contig2224:197..1066. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH12_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 12 OS=Arabidopsis thaliana GN=XTH12 PE=2 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 4.169e-96
Identity = 165/247 (66.80%), Postives = 190/247 (76.92%), Query Frame = 2
Query:    2 ILNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANAC-----VWXXXXXXXXXXXXXPWFSQELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKECAFN 727
            I  +GQLL+ +LDK SGSGFQSK EYLFGKIDM++KLVPGNSAGTVTAYYL S G TWDEIDFEFLGN++G PY +HTNVFT GKG+RE QF+LWFDPTADFHTY+VLWNP  I+F VDG PIR FKN E+NGV +PK+QPM+IYSSLW ADDWAT+GG +KTDWT APF+ASYR+FN   C     +W              W    L++    +LKWVQK+YMIYNYC D KRFPQGLP EC  N
Sbjct:   42 IFESGQLLTCTLDKTSGSGFQSKKEYLFGKIDMKIKLVPGNSAGTVTAYYLSSKGETWDEIDFEFLGNVTGQPYVIHTNVFTGGKGNREMQFYLWFDPTADFHTYTVLWNPLNIIFLVDGIPIRVFKNNEANGVAYPKSQPMKIYSSLWEADDWATQGGKVKTDWTNAPFSASYRSFNDVDCCSRTSIW---NWVTCNANSNSWMWTTLNSNQLGQLKWVQKDYMIYNYCTDFKRFPQGLPTECNLN 285          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH13_ARATH (Putative xyloglucan endotransglucosylase/hydrolase protein 13 OS=Arabidopsis thaliana GN=XTH13 PE=2 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 6.656e-94
Identity = 161/244 (65.98%), Postives = 187/244 (76.64%), Query Frame = 2
Query:    2 ILNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACV--WXXXXXXXXXXXXXPWFSQELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKECAFN 727
            I+ +GQLL+ +LDK SGSGFQSK EYLFGKIDM++KLV GNSAGTVTAYYL S G TWDEIDFEFLGN++G PY LHTNVFT GKG+RE QF+LWFDPTADFHTY+VLWNP  I+F VDG PIR FKN E+NGV +PK+QPM+IYSSLW ADDWAT+GG +KTDWT APF+ASY++FN   C                  W    L++    ++KWVQ +YMIYNYC D KRFPQGLP EC  N
Sbjct:   41 IVESGQLLTCTLDKISGSGFQSKKEYLFGKIDMKMKLVAGNSAGTVTAYYLSSKGETWDEIDFEFLGNVTGQPYVLHTNVFTGGKGNREMQFYLWFDPTADFHTYTVLWNPLNIIFLVDGIPIRVFKNNEANGVAYPKSQPMKIYSSLWEADDWATQGGKVKTDWTNAPFSASYKSFNDVDCCSRTSLLNWVTCNANSNSWMWTTLNSNQYGQMKWVQDDYMIYNYCTDFKRFPQGLPTECNLN 284          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH15_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 15 OS=Arabidopsis thaliana GN=XTH15 PE=1 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 7.359e-93
Identity = 163/242 (67.36%), Postives = 183/242 (75.62%), Query Frame = 2
Query:    2 ILNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFSQ---ELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            I N G +LSLSLD+ SGSGF+SK EYLFG+IDMQLKLV GNSAGTVTAYYL S G+T DEIDFEFLGN +G PY LHTNVF  GKGDREQQF+LWFDPT +FHTYS++W PQ I+F VD  PIR F N E  GV FPK+QPMRIYSSLWNADDWATRGGL+KTDW++APFTA YR FNA AC                   Q   EL+  G+ RL+WVQK +MIYNYC D KRFP+G P EC
Sbjct:   43 IFNGGNMLSLSLDQVSGSGFKSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQGATHDEIDFEFLGNETGKPYVLHTNVFAQGKGDREQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKSQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFNAAACTASSGCDPKFKSSFGDGKLQVATELNAYGRRRLRWVQKYFMIYNYCSDLKRFPRGFPPEC 284          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH14_ARATH (Xyloglucan endotransglucosylase/hydrolase protein 14 OS=Arabidopsis thaliana GN=XTH14 PE=1 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 7.359e-93
Identity = 161/241 (66.80%), Postives = 180/241 (74.69%), Query Frame = 2
Query:    2 ILNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFN--ANACVWXXXXXXXXXXXXXPWFSQELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            I  NGQLL+ +LDK SGSGFQSK EYLFGKIDM+LKLV GNSAGTVTAYYL S G+ WDEIDFEFLGN +G PYT+HTNVFT GKGDRE QF LWFDPTADFHTY+V WNP  I+F VDG PIR FKN E NGV +PKNQPMRIYSSLW ADDWAT GG +K DW+ APF ASYRNFN  ++                  W    L+     ++ WVQ+++MIYNYC D KRFPQGLPKEC
Sbjct:   45 IFENGQLLTCTLDKVSGSGFQSKKEYLFGKIDMKLKLVAGNSAGTVTAYYLSSKGTAWDEIDFEFLGNRTGHPYTIHTNVFTGGKGDREMQFRLWFDPTADFHTYTVHWNPVNIIFLVDGIPIRVFKNNEKNGVAYPKNQPMRIYSSLWEADDWATEGGRVKIDWSNAPFKASYRNFNDQSSCSRTSSSKWVTCEPNSNSWMWTTLNPAQYGKMMWVQRDFMIYNYCTDFKRFPQGLPKEC 285          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH16_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 16 OS=Arabidopsis thaliana GN=XTH16 PE=2 SV=2)

HSP 1 Score: 336.65 bits (862), Expect = 1.063e-91
Identity = 160/245 (65.31%), Postives = 184/245 (75.10%), Query Frame = 2
Query:    2 ILNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACV------WXXXXXXXXXXXXXPWFSQELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            I + G++LSLSLD+ SGSGF+SK EYLFG+IDMQLKLV GNSAGTVTAYYL S G T DEIDFEFLGN +G PY LHTNVF  GKG+REQQF+LWFDPT +FHTYS++W PQ I+F VD  PIR F N E  GV FPKNQPM+IYSSLWNADDWATRGGL+KTDW++APFTA YR FNA AC       +                + EL+  G+ RL+WVQK +MIY+YC D KRFPQG P EC
Sbjct:   42 IFSGGKMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSEGPTHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFHTYSLVWRPQHIIFMVDNVPIRVFNNAEQLGVPFPKNQPMKIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFNAAACTVSSGSSFCDPKFKSSFTNGESQVANELNAYGRRRLRWVQKYFMIYDYCSDLKRFPQGFPPEC 286          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTHA_PHAAN (Xyloglucan endotransglucosylase/hydrolase protein A OS=Phaseolus angularis GN=XTHA PE=1 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 1.261e-76
Identity = 140/241 (58.09%), Postives = 164/241 (68.05%), Query Frame = 2
Query:    5 LNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFSQE---LDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            LN G  + L LDK +G+GFQSK  YLFG   M +KLVPG+SAGTVTA+YL S  +  DEIDFEFLGN +G PY L TNVFT GKGDREQ+ +LWFDPT  +H YSVLWN  +IVFYVD  PIR FKN    GV FP NQPM+IY+SLWNADDWATRGGL KTDW++APF ASY+ F+ + C                W   E   LD    ++L WV+  Y IYNYC D KR+ Q +P EC
Sbjct:   47 LNGGSEIQLHLDKYTGTGFQSKGSYLFGHFSMYIKLVPGDSAGTVTAFYLSSTNAEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTTQYHRYSVLWNMYQIVFYVDDYPIRVFKNSNDLGVKFPFNQPMKIYNSLWNADDWATRGGLEKTDWSKAPFIASYKGFHIDGCEASVNAKFCDTQGKRWWDQPEFRDLDAAQWQKLAWVRNKYTIYNYCTDRKRYSQ-VPPEC 286          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH_SOYBN (Probable xyloglucan endotransglucosylase/hydrolase (Fragment) OS=Glycine max GN=XTH PE=2 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 4.792e-76
Identity = 135/240 (56.25%), Postives = 166/240 (69.17%), Query Frame = 2
Query:    8 NNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFSQE---LDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            N G  + L LDK +G+GFQSK  YLFG   M +K+VPG+SAGTVTA+YL S  +  DEIDFEFLGN +G PY L TNVFT GKGDREQ+ +LWFDPT ++H YS+LWN  +IVF+VD  PIR FKN +  GV FP +QPM+IY+SLWNADDWATRGGL KTDW++APF A+Y+ F+ + C                W   E   LD     RL+WV++ Y IYNYC D+KR+P   P EC
Sbjct:   50 NGGSDIQLHLDKYTGTGFQSKGSYLFGHFSMYIKMVPGDSAGTVTAFYLSSQNAEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKEYHRYSILWNLYQIVFFVDEVPIRVFKNSKDLGVKFPFDQPMKIYNSLWNADDWATRGGLEKTDWSKAPFIAAYKGFHIDGCEASVNAKFCDTQGKRWWDQPEFRDLDAAQWRRLRWVRQKYTIYNYCTDTKRYPHISPPEC 289          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH5_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 5 OS=Arabidopsis thaliana GN=XTH5 PE=2 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 1.394e-75
Identity = 140/241 (58.09%), Postives = 165/241 (68.46%), Query Frame = 2
Query:    5 LNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFS---QELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            LN G  + L LDK +G+GFQSK  YLFG   M +K+V G+SAGTVTA+YL S  S  DEIDFEFLGN +G PY L TNVFT G G+REQ+ +LWFDP+ D+H+YSVLWN  +IVF+VD  PIR FKN +  GV FP NQPM+IYSSLWNADDWATRGGL KT+W +APF ASYR F+ + C                W     Q+LD    +RLKWV+K Y IYNYC D  RFP   P EC
Sbjct:   48 LNGGSEVHLVLDKYTGTGFQSKGSYLFGHFSMHIKMVAGDSAGTVTAFYLSSQNSEHDEIDFEFLGNRTGQPYILQTNVFTGGAGNREQRINLWFDPSKDYHSYSVLWNMYQIVFFVDDVPIRVFKNSKDVGVKFPFNQPMKIYSSLWNADDWATRGGLEKTNWEKAPFVASYRGFHVDGCEASVNAKFCETQGKRWWDQKEFQDLDANQYKRLKWVRKRYTIYNYCTDRVRFPVP-PPEC 287          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH_TOBAC (Probable xyloglucan endotransglucosylase/hydrolase protein OS=Nicotiana tabacum GN=XTH PE=2 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 2.378e-75
Identity = 139/243 (57.20%), Postives = 168/243 (69.14%), Query Frame = 2
Query:    5 LNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANAC-VWXXXXXXXXXXXXXPWFS----QELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            L+ G  + L LD++SG+GFQSK  YLFG   M+LKLV G+SAG VTA+YL S  +  DEIDFEFLGN +G PY L TNVFT GKGDREQ+ +LWFDPT  +H+YSVLWN  +IV +VD  PIR FKN +  GV FP NQPM+IYSSLW+ADDWATRGGL KTDW+ APFTASY +F+ + C                 W+     Q+LD     RL+WV++ Y IYNYC D KR+P  LP EC
Sbjct:   48 LSGGSTVDLVLDRSSGAGFQSKKSYLFGHFSMKLKLVGGDSAGVVTAFYLSSNNAEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKGYHSYSVLWNTFQIVIFVDDVPIRAFKNSKDLGVKFPFNQPMKIYSSLWDADDWATRGGLEKTDWSNAPFTASYTSFHVDGCEAATPQEVQVCNTKGMRWWDQKAFQDLDALQYRRLRWVRQKYTIYNYCTDRKRYPT-LPPEC 289          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTHB_PHAAN (Probable xyloglucan endotransglucosylase/hydrolase protein B OS=Phaseolus angularis GN=XTHB PE=2 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 2.378e-75
Identity = 137/243 (56.38%), Postives = 165/243 (67.90%), Query Frame = 2
Query:    8 NNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFSQE---LDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKECAFN 727
            N G  + L LDK +G+GFQ+K  YLFG   M +K+VPG+SAGTVTA+ L S  +  DEIDFEFLGN +G PY L TNVFT GKGDREQ+ +LWFDPT  +H YSVLWN  +IVF VD  PIR FKNL+  GV FP NQPM++Y+SLWNADDWATRGGL KTDW++APF A Y+ F+ + C                W   E   LD+    RLKWV++ + IYNYC D  R+PQ LP EC  N
Sbjct:   49 NGGSEIQLHLDKYTGTGFQTKGSYLFGHFSMNIKMVPGDSAGTVTAFCLSSQNAEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKAYHRYSVLWNMYQIVFLVDNIPIRVFKNLKELGVKFPFNQPMKVYNSLWNADDWATRGGLEKTDWSKAPFVAEYKGFHVDGCEASVNSRFCATQGKRWWDQTEFRDLDSFQWRRLKWVRQKFTIYNYCTDRTRYPQ-LPPECRRN 290          
The following BLAST results are available for this feature:
BLAST of DC899998 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 54
Match NameE-valueIdentityDescription
XTH12_ARATH4.169e-9666.80Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH13_ARATH6.656e-9465.98Putative xyloglucan endotransglucosylase/hydrolase... [more]
XTH15_ARATH7.359e-9367.36Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH14_ARATH7.359e-9366.80Xyloglucan endotransglucosylase/hydrolase protein ... [more]
XTH16_ARATH1.063e-9165.31Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTHA_PHAAN1.261e-7658.09Xyloglucan endotransglucosylase/hydrolase protein ... [more]
XTH_SOYBN4.792e-7656.25Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH5_ARATH1.394e-7558.09Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH_TOBAC2.378e-7557.20Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTHB_PHAAN2.378e-7556.38Probable xyloglucan endotransglucosylase/hydrolase... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899998 VSS Citrus sinensis cDNA clone VS27Q09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899998 ID=DC899998|Name=DC899998|organism=Citrus sinensis|type=EST|length=870bp
GATACTCAACAACGGCCAGCTTCTCTCCCTCTCCCTTGACAAAGCCTCAG
GCTCAGGCTTCCAGTCCAAGAGCGAGTACCTTTTTGGCAAAATCGACATG
CAACTCAAGCTTGTCCCTGGCAATTCTGCCGGCACAGTCACCGCCTACTA
CTTAAAATCACCAGGATCAACATGGGATGAGATAGACTTTGAATTCTTGG
GGAATTTAAGTGGTGATCCTTATACTCTTCATACTAATGTGTTCACAAAT
GGCAAAGGTGACAGAGAGCAACAATTCCACCTCTGGTTTGACCCCACTGC
TGACTTTCACACCTATTCCGTTCTCTGGAACCCCCAACGTATTGTCTTCT
ATGTTGATGGCTCGCCAATTAGAGAGTTCAAGAACTTGGAATCAAACGGC
GTACTCTTTCCCAAAAACCAGCCGATGAGGATTTACTCGAGTCTCTGGAA
CGCCGATGACTGGGCCACGAGAGGTGGCCTTATCAAAACTGACTGGACCC
AAGCTCCCTTCACTGCTTCTTACAGAAACTTCAATGCCAATGCTTGCGTC
TGGTCTAATGGAAAATCCTCTTGCAACTCAAAAAATAATAATCCATGGTT
CTCGCAAGAACTTGATACCNCTGGCCAAGAGAGACTCAAATGGGTGCAGA
AGAATTACATGATATATAATTATTGCAAGGACTCAAAACGATTTCCCCAA
GGGCTCCCAAAAGAATGTGCATTCAATATATAACTGATCCATTTGCCATA
TGTCTTTGTTTATAGCTTTTTTAATCTTCAGTTTTGATGTTTTGGTTCTT
TTATTCTGTGTACTAATGTTTAGTGACAAATAAAATGTATGGTTCATTCT
TTTTTGTACTATAAGTGCTA
back to top