DC899998

Overview
NameDC899998
Unique NameDC899998
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length870
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2224 contig Csv1_Contig2224:197..1066. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH_WHEAT (Probable xyloglucan endotransglucosylase/hydrolase OS=Triticum aestivum GN=XTH PE=2 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 3.797e-73
Identity = 133/241 (55.19%), Postives = 164/241 (68.05%), Query Frame = 2
Query:    5 LNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFS---QELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            +N G+ + LSLDK +G+GFQ++  YLFG   M +KLV G+SAGTVTA+YL S  S  DEIDFEFLGN +G PY L TNVF+ GKGDREQ+ +LWFDPT D+H+YSVLWN   I F+VD +PIR FKN +  GV +P +QPM++YSSLWNADDWATRGG  KTDW++APF ASYR F+ + C                W     Q+LD     RL WV+K + IYNYC D  R+    P EC
Sbjct:   48 VNGGREVQLSLDKTTGTGFQTRGSYLFGHFSMHIKLVGGDSAGTVTAFYLSSQNSEHDEIDFEFLGNRTGQPYILQTNVFSGGKGDREQRIYLWFDPTKDYHSYSVLWNLYMIAFFVDDTPIRVFKNSKDLGVRYPFDQPMKLYSSLWNADDWATRGGREKTDWSKAPFVASYRGFHVDGCEASAEAKFCATQGARWWDQPEFQDLDAAQYRRLAWVRKEHTIYNYCTDHDRYAAMAP-EC 287          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH_BRAOB (Xyloglucan endotransglucosylase/hydrolase OS=Brassica oleracea var. botrytis GN=XET16A PE=1 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 2.461e-72
Identity = 135/241 (56.02%), Postives = 159/241 (65.98%), Query Frame = 2
Query:    5 LNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFSQE---LDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            LN G  L L LDK +G+GFQSK  YLFG   M +KL  G++AG VTA+YL S  +  DEIDFEFLGN +G P  L TNVFT GKG+REQ+ +LWFDP+  +HTYSVLWN  +IVF+VD  PIR FKN +  GV FP NQPM++YSSLWNADDWATRGGL KT+W  APF ASYR F+ + C                W   E   LD     RLKWV+  + IYNYC D  RFP  +P EC
Sbjct:   50 LNGGSELQLILDKYTGTGFQSKGSYLFGHFSMHIKLPAGDTAGVVTAFYLSSTNNEHDEIDFEFLGNRTGQPVILQTNVFTGGKGNREQRIYLWFDPSKAYHTYSVLWNLYQIVFFVDNIPIRVFKNAKDLGVRFPFNQPMKLYSSLWNADDWATRGGLEKTNWANAPFIASYRGFHIDGCQASVEAKYCATQGRMWWDQNEFRDLDAEQYRRLKWVRMKWTIYNYCTDRTRFPV-MPAEC 289          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH1_SOLLC (Probable xyloglucan endotransglucosylase/hydrolase 1 OS=Solanum lycopersicum GN=XTH1 PE=2 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 3.214e-72
Identity = 133/243 (54.73%), Postives = 163/243 (67.08%), Query Frame = 2
Query:    5 LNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANAC-VWXXXXXXXXXXXXXPWFS----QELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            LN G    L LD++SG+GFQSK  YLFG   M+++LV G+SAG VTA+YL S  +  DEIDFEFLGN +G PY L TNVFT GKG+REQ+ +LWFDPT  +H+YSVLWN   IV +VD  PIR FKN +  GV FP NQPM+IYSSLW+ADDWATRGGL KT+W  APFTASY +F+ + C                 W+     Q+LD     RL+WV++ Y +YNYC D  R+P   P EC
Sbjct:   49 LNGGTTTDLILDRSSGAGFQSKKSYLFGHFSMKMRLVGGDSAGVVTAFYLSSNNAEHDEIDFEFLGNRTGQPYILQTNVFTGGKGNREQRIYLWFDPTKGYHSYSVLWNTYLIVIFVDDVPIRAFKNSKDLGVKFPFNQPMKIYSSLWDADDWATRGGLEKTNWANAPFTASYTSFHVDGCEAATPQEVQVCNTKGMKWWDQKAFQDLDALQYRRLRWVRQKYTVYNYCTDKARYPVP-PPEC 290          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH4_ARATH (Xyloglucan endotransglucosylase/hydrolase protein 4 OS=Arabidopsis thaliana GN=XTH4 PE=1 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 1.221e-71
Identity = 132/240 (55.00%), Postives = 159/240 (66.25%), Query Frame = 2
Query:    8 NNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFSQE---LDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            N G  L L LDK +G+GFQSK  YLFG   M +KL  G++AG VTA+YL S  +  DEIDFEFLGN +G P  L TNVFT GKG+REQ+ +LWFDP+  +HTYS+LWN  +IVF+VD  PIR FKN +  GV FP NQPM++YSSLWNADDWATRGGL KT+W  APF ASY+ F+ + C                W  +E   LD     RLKWV+  + IYNYC D  RFP  +P EC
Sbjct:   52 NGGSELQLILDKYTGTGFQSKGSYLFGHFSMHIKLPAGDTAGVVTAFYLSSTNNEHDEIDFEFLGNRTGQPAILQTNVFTGGKGNREQRIYLWFDPSKAYHTYSILWNMYQIVFFVDNIPIRTFKNAKDLGVRFPFNQPMKLYSSLWNADDWATRGGLEKTNWANAPFVASYKGFHIDGCQASVEAKYCATQGRMWWDQKEFRDLDAEQWRRLKWVRMKWTIYNYCTDRTRFPV-MPAEC 290          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH26_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 26 OS=Arabidopsis thaliana GN=XTH26 PE=2 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 1.221e-71
Identity = 125/245 (51.02%), Postives = 167/245 (68.16%), Query Frame = 2
Query:   11 NGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVW--------XXXXXXXXXXXXXPWFSQELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKECA 721
            NG  L L LDK++GS  +SK  +LFG ++M +KLVPGNSAGTV AYYL S GST DEIDFEFLGN +G PYT+HTN++  GKG+REQQF  WF+PT  FH Y++ WNP  +V++VDG+PIR F+N ES G+ +P  Q M++++SLWNA+DWAT+GG +KT+WT APF A  R + A AC+W                     P FSQ L      +++ ++  +MIY+YCKD+ RF   +P EC+
Sbjct:   45 NGTNLRLVLDKSAGSAIKSKVAHLFGSVEMLIKLVPGNSAGTVAAYYLSSTGSTHDEIDFEFLGNATGQPYTIHTNLYAQGKGNREQQFRPWFNPTNGFHNYTIHWNPSEVVWFVDGTPIRVFRNYESEGIAYPNKQGMKVFASLWNAEDWATQGGRVKTNWTLAPFVAEGRRYKARACLWKGSVSIKQCVDPTIRSNWWTSPSFSQ-LTASQLTKMQKIRDGFMIYDYCKDTNRFKGVMPPECS 288          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH9_ARATH (Xyloglucan endotransglucosylase/hydrolase protein 9 OS=Arabidopsis thaliana GN=XTH9 PE=2 SV=2)

HSP 1 Score: 268.47 bits (685), Expect = 3.554e-71
Identity = 125/243 (51.44%), Postives = 170/243 (69.96%), Query Frame = 2
Query:    5 LNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANAC-VWXXXXXXXXXXXXXPWFSQ----ELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            +N G++  L LD  SG+GF+S+S+YLFGK+ +Q+KLV G+SAGTVTA+Y+ S G   +E DFEFLGN +G+PY + TN++ NG G+REQ+ +LWFDPT +FHTYS+LW+ + +VF VD +PIR  KNLE  G+ F K+Q M +YSS+WNADDWAT+GGL+KTDW+ APF ASY+ F  +AC +               W+ +    EL      +L WV+ N+MIY+YC D+ RFP   P EC
Sbjct:   43 VNEGEVTKLKLDNYSGAGFESRSKYLFGKVSIQIKLVEGDSAGTVTAFYMSSDGPNHNEFDFEFLGNTTGEPYIVQTNIYVNGVGNREQRLNLWFDPTTEFHTYSILWSKRSVVFMVDETPIRVQKNLEEKGIPFAKDQAMGVYSSIWNADDWATQGGLVKTDWSHAPFVASYKEFQIDACEIPTTTDLSKCNGDQKFWWDEPTVSELSLHQNHQLIWVRANHMIYDYCFDATRFPV-TPLEC 284          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH8_ORYSJ (Xyloglucan endotransglycosylase/hydrolase protein 8 OS=Oryza sativa subsp. japonica GN=XTH8 PE=1 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 1.950e-69
Identity = 122/239 (51.05%), Postives = 162/239 (67.78%), Query Frame = 2
Query:   17 QLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKS-PGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACV----WXXXXXXXXXXXXXPWFSQELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            Q ++L+LD++SGSGF SK  YLFG+  +Q+KLV GNSAGTVT++YL S  G   DEID EF+GNLSG+PY ++TNV+ NG G +E QF+LWFDPTADFHTY ++WNPQ I+F VD  P+R FK  +   + +P+++PMR++++LW+   WATR G +K DW+ APF  SYR ++ NACV                   W  +ELD      + W ++NYM YNYC D  RFPQG P EC
Sbjct:   51 QQVALTLDRSSGSGFTSKDTYLFGEFSVQMKLVGGNSAGTVTSFYLSSGEGDGHDEIDIEFMGNLSGNPYVMNTNVWANGDGKKEHQFYLWFDPTADFHTYKIIWNPQNIIFQVDDVPVRTFKKYDD--LAYPQSKPMRLHATLWDGSYWATRHGDVKIDWSGAPFVVSYRGYSTNACVNNNPAGGWSSSWCPEGTSAWIHRELDGAELGTVAWAERNYMSYNYCADGWRFPQGFPAEC 287          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH6_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 6 OS=Arabidopsis thaliana GN=XTH6 PE=2 SV=2)

HSP 1 Score: 262.692 bits (670), Expect = 1.950e-69
Identity = 121/243 (49.79%), Postives = 170/243 (69.96%), Query Frame = 2
Query:    5 LNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTW-DEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFS----QELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            + +G+ + L LD+++G GF SK +YLFG++ M++KL+PG+SAGTVTA+Y+ S  +T  DE+DFEFLGN SG PY++ TN+F +GKGDREQ+ +LWFDP+ D+HTY++LW+ + IVFYVD  PIRE+KN E+  + +P +QPM +YS+LW ADDWATRGGL K DW++APF A Y++F+   C                W+     Q L+     R +WV+ N+M+Y+YC D  RFP   P EC
Sbjct:   51 MEDGKAIQLVLDQSTGCGFASKRKYLFGRVSMKIKLIPGDSAGTVTAFYMNSDTATVRDELDFEFLGNRSGQPYSVQTNIFAHGKGDREQRVNLWFDPSMDYHTYTILWSHKHIVFYVDDVPIREYKNNEAKNIAYPTSQPMGVYSTLWEADDWATRGGLEKIDWSKAPFYAYYKDFDIEGC--PVPGPTFCPSNPHNWWEGYAYQSLNAVEARRYRWVRVNHMVYDYCTDRSRFPVP-PPEC 290          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH7_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 7 OS=Arabidopsis thaliana GN=XTH7 PE=2 SV=2)

HSP 1 Score: 256.144 bits (653), Expect = 1.825e-67
Identity = 122/247 (49.39%), Postives = 165/247 (66.80%), Query Frame = 2
Query:    5 LNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFS----QELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKECAFNI 730
            ++ G+ + L LD +SG GF SK +YLFG++ M++KL+PG+SAGTVTA+Y+ S   S  DE+DFEFLGN SG PYT+ TNVF +GKGDREQ+ +LWFDP+ DFH Y++ WN  RIVFYVD  PIR +KN E+  V +P+ QPM +YS+LW ADDWATRGG+ K +W++APF A Y++F+   C                W+      +L        +WV+ N+M+Y+YC D  RFP   P EC+  I
Sbjct:   50 IDGGRAIQLKLDPSSGCGFASKKQYLFGRVSMKIKLIPGDSAGTVTAFYMNSDTDSVRDELDFEFLGNRSGQPYTVQTNVFAHGKGDREQRVNLWFDPSRDFHEYAISWNHLRIVFYVDNVPIRVYKNNEARKVPYPRFQPMGVYSTLWEADDWATRGGIEKINWSRAPFYAYYKDFDIEGC--PVPGPADCPANSKNWWEGSAYHQLSPVEARSYRWVRVNHMVYDYCTDKSRFPVP-PPECSAGI 293          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH8_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 8 OS=Arabidopsis thaliana GN=XTH8 PE=2 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 6.936e-67
Identity = 124/249 (49.80%), Postives = 163/249 (65.46%), Query Frame = 2
Query:    8 NNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSP---GSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLES--NGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFSQ----ELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKECAFN 727
            ++G++ +LSLD  +G GFQ+K  Y FG   M+LKLV G+SAG VTAYY+ S    G   DEIDFEFLGN +G PY + TNV+ NG G+RE +  LWFDPT D+HTYS+LWN  ++VF+VD  PIR +KN +   N   FP  +PM ++SS+WNADDWATRGGL KTDW +APF +SY++F    C W              W+ Q     L    +    WVQ+N ++Y+YCKDS+RFP  LP EC+ +
Sbjct:   42 DDGEIWNLSLDNDTGCGFQTKHMYRFGWFSMKLKLVGGDSAGVVTAYYMCSENGAGPERDEIDFEFLGNRTGQPYIIQTNVYKNGTGNREMRHSLWFDPTKDYHTYSILWNNHQLVFFVDRVPIRVYKNSDKVPNNDFFPNQKPMYLFSSIWNADDWATRGGLEKTDWKKAPFVSSYKDFAVEGCRWKDPFPACVSTTTENWWDQYDAWHLSKTQKMDYAWVQRNLVVYDYCKDSERFPT-LPWECSIS 289          
The following BLAST results are available for this feature:
BLAST of DC899998 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 54
Match NameE-valueIdentityDescription
XTH_WHEAT3.797e-7355.19Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH_BRAOB2.461e-7256.02Xyloglucan endotransglucosylase/hydrolase OS=Brass... [more]
XTH1_SOLLC3.214e-7254.73Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH4_ARATH1.221e-7155.00Xyloglucan endotransglucosylase/hydrolase protein ... [more]
XTH26_ARATH1.221e-7151.02Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH9_ARATH3.554e-7151.44Xyloglucan endotransglucosylase/hydrolase protein ... [more]
XTH8_ORYSJ1.950e-6951.05Xyloglucan endotransglycosylase/hydrolase protein ... [more]
XTH6_ARATH1.950e-6949.79Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH7_ARATH1.825e-6749.39Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH8_ARATH6.936e-6749.80Probable xyloglucan endotransglucosylase/hydrolase... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899998 VSS Citrus sinensis cDNA clone VS27Q09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899998 ID=DC899998|Name=DC899998|organism=Citrus sinensis|type=EST|length=870bp
GATACTCAACAACGGCCAGCTTCTCTCCCTCTCCCTTGACAAAGCCTCAG
GCTCAGGCTTCCAGTCCAAGAGCGAGTACCTTTTTGGCAAAATCGACATG
CAACTCAAGCTTGTCCCTGGCAATTCTGCCGGCACAGTCACCGCCTACTA
CTTAAAATCACCAGGATCAACATGGGATGAGATAGACTTTGAATTCTTGG
GGAATTTAAGTGGTGATCCTTATACTCTTCATACTAATGTGTTCACAAAT
GGCAAAGGTGACAGAGAGCAACAATTCCACCTCTGGTTTGACCCCACTGC
TGACTTTCACACCTATTCCGTTCTCTGGAACCCCCAACGTATTGTCTTCT
ATGTTGATGGCTCGCCAATTAGAGAGTTCAAGAACTTGGAATCAAACGGC
GTACTCTTTCCCAAAAACCAGCCGATGAGGATTTACTCGAGTCTCTGGAA
CGCCGATGACTGGGCCACGAGAGGTGGCCTTATCAAAACTGACTGGACCC
AAGCTCCCTTCACTGCTTCTTACAGAAACTTCAATGCCAATGCTTGCGTC
TGGTCTAATGGAAAATCCTCTTGCAACTCAAAAAATAATAATCCATGGTT
CTCGCAAGAACTTGATACCNCTGGCCAAGAGAGACTCAAATGGGTGCAGA
AGAATTACATGATATATAATTATTGCAAGGACTCAAAACGATTTCCCCAA
GGGCTCCCAAAAGAATGTGCATTCAATATATAACTGATCCATTTGCCATA
TGTCTTTGTTTATAGCTTTTTTAATCTTCAGTTTTGATGTTTTGGTTCTT
TTATTCTGTGTACTAATGTTTAGTGACAAATAAAATGTATGGTTCATTCT
TTTTTGTACTATAAGTGCTA
back to top