DC899998

Overview
NameDC899998
Unique NameDC899998
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length870
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2224 contig Csv1_Contig2224:197..1066. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH10_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 10 OS=Arabidopsis thaliana GN=XTH10 PE=2 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 4.970e-65
Identity = 114/242 (47.11%), Postives = 158/242 (65.29%), Query Frame = 2
Query:    8 NNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFSQ----ELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKECA 721
            N+G+  +L LD+ SG+ F S   +LFG+IDM++KL+ G+S GTV AYY+ S     DEIDFEFLGN++G PY L TNV+  G  +RE++ HLWFDP  DFHTYS+LWN  +IVF VD  PIR ++N    GV +P+ QPM + +SLWN + WATRGG  K DW++ PF AS+ ++  +AC+W              W+++     L    +   KWV+K ++IY+YC+D  RF   LPKEC+
Sbjct:   54 NDGRSRTLKLDQESGASFSSIQTFLFGQIDMKIKLIRGSSQGTVVAYYMSSDQPNRDEIDFEFLGNVNGQPYILQTNVYAEGLDNREERIHLWFDPAKDFHTYSILWNIHQIVFMVDQIPIRLYRNHGEKGVAYPRLQPMSVQASLWNGESWATRGGHDKIDWSKGPFVASFGDYKIDACIWIGNTSFCNGESTENWWNKNEFSSLTRVQKRWFKWVRKYHLIYDYCQDYGRFNNKLPKECS 295          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH2_ARATH (Xyloglucan endotransglucosylase/hydrolase protein 2 OS=Arabidopsis thaliana GN=XTH2 PE=2 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 2.553e-61
Identity = 118/246 (47.97%), Postives = 159/246 (64.63%), Query Frame = 2
Query:    5 LNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANAC-VWXXXXXXXXXXXXXPWFS----QELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKECAFN 727
            LN G+ + LS+D +SGSGF+SKS Y  G   M++KL P +SAG VTA+YL S G T DE+DFEFLGN  G P  + TNVF+NG+G REQ+F  WFDPT  FHTY +LWNP +IVFYVD  PIR FKN++ +GV +P ++PM++ +SLWN ++WAT GG  K +W  APF A Y+ F+ + C V               W++     +L    Q+ ++ V+  YM Y+YC D  R+P   P EC +N
Sbjct:   48 LNQGKEVQLSMDYSSGSGFESKSHYGSGFFQMRIKLPPRDSAGVVTAFYLTSKGDTHDEVDFEFLGNRQGKPIAIQTNVFSNGQGGREQKFVPWFDPTTSFHTYGILWNPYQIVFYVDKVPIRVFKNIKKSGVNYP-SKPMQLVASLWNGENWATSGGKEKINWAYAPFKAQYQGFSDHGCHVNGQSNNANVCGSTRYWWNTRTYSQLSANEQKVMENVRAKYMTYDYCSDRPRYPVP-PSECRWN 291          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH1_ARATH (Putative xyloglucan endotransglucosylase/hydrolase protein 1 OS=Arabidopsis thaliana GN=XTH1 PE=2 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 6.507e-57
Identity = 112/245 (45.71%), Postives = 157/245 (64.08%), Query Frame = 2
Query:    5 LNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFS----QELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKECAFN 727
            LN G+ + LSLD +SGSGF+SK+ Y  G   +++K+ P +++G VTA+YL S G+T DE+DFEFLGN  G    + TNVFTNGKG+REQ+  LWFDP+ DFHTY++LWNP +IV YVD  P+R FKN  S G+ +P ++PM++  SLWN ++WAT GG  K +W+ APF A+++ FN + C                W++     +L    Q+    V++ YM Y+YC D  RF    P EC +N
Sbjct:   55 LNQGKEVQLSLDHSSGSGFESKNHYESGFFQIRIKVPPKDTSGVVTAFYLTSKGNTHDEVDFEFLGNKEGK-LAVQTNVFTNGKGNREQKLALWFDPSKDFHTYAILWNPYQIVLYVDNIPVRVFKNTTSQGMNYP-SKPMQVVVSLWNGENWATDGGKSKINWSLAPFKANFQGFNNSGCFTNAEKNACGSSAY--WWNTGSYSKLSDSEQKAYTNVRQKYMNYDYCSDKVRF-HVPPSECKWN 294          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH3_ARATH (Xyloglucan endotransglucosylase/hydrolase protein 3 OS=Arabidopsis thaliana GN=XTH3 PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 2.473e-56
Identity = 110/243 (45.27%), Postives = 157/243 (64.61%), Query Frame = 2
Query:    5 LNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANAC-VWXXXXXXXXXXXXXPWFS----QELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            L++G+ + L +D++SG GF+SK  Y  G  +M++K+  GN+ G VTA+YL S G   DEIDFEFLGN +G P TL TN+F NG+G+RE++F LWF+PT  +HTY +LWNP +IVFYVD  PIR +KN   NGV +P ++PM++ +SLWN DDWAT GG  K +W+ +PF A +R+F  + C +               W++    Q L    Q+  + V+  YM Y+YC D  ++ Q  P+EC
Sbjct:   51 LHSGEEVDLYMDQSSGGGFESKDAYGSGLFEMRIKVPSGNTGGIVTAFYLTSKGGGHDEIDFEFLGNNNGKPVTLQTNLFLNGEGNREERFLLWFNPTKHYHTYGLLWNPYQIVFYVDNIPIRVYKN--ENGVSYP-SKPMQVEASLWNGDDWATDGGRTKVNWSYSPFIAHFRDFALSGCNIDGRSNNVGACESSNYWWNAGNYQRLSGNEQKLYEHVRSKYMNYDYCTDRSKY-QTPPREC 289          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH31_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 31 OS=Arabidopsis thaliana GN=XTH31 PE=2 SV=2)

HSP 1 Score: 194.897 bits (494), Expect = 4.994e-49
Identity = 102/233 (43.78%), Postives = 133/233 (57.08%), Query Frame = 2
Query:   20 LLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKS----PGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDR-----EQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFSQELDTXGQERLKWVQKNYMIYNYCKDSKR 691
            +++L LDK++GSGF+S   Y  G     +KL PG +AG  T+ YL +    PG   DE+D EFLG   G PY+L TNVF  G GDR     E +F LWFDPT DFH Y++LWNP +IVF+VD  PIR +     N  +FP  +PM +Y S+W+A DWAT  G IK D+   PF A Y+NF    C               P  ++ L       L W Q+N+++YNYC D KR
Sbjct:   58 VVTLWLDKSTGSGFKSLRPYRSGYFGASIKLQPGFTAGVDTSLYLSNNQEHPGDH-DEVDIEFLGTTPGKPYSLQTNVFVRGSGDRNVIGREMKFTLWFDPTQDFHHYAILWNPNQIVFFVDDVPIRTYN--RKNEAIFP-TRPMWVYGSIWDASDWATENGRIKADYRYQPFVAKYKNFKLAGCT-ADSSSSCRPPSPAPMRNRGLSRQQMAALTWAQRNFLVYNYCHDPKR 285          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH32_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 32 OS=Arabidopsis thaliana GN=XTH32 PE=2 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 3.579e-47
Identity = 103/241 (42.74%), Postives = 135/241 (56.02%), Query Frame = 2
Query:   23 LSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKS----PGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGD-----REQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFSQELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            L++ LD+ SGSGF+S   +  G     +KL PG +AG +T+ YL +    PG   DE+D EFLG   G PYTL TNV+  G GD     RE +F LWFDPT DFH Y++LW+P+ I+F VD  PIR +   + +   FP  +PM +Y S+W+A  WAT  G  K D+   PFTA Y NF A  C               P+ S  L     + ++WVQ + M+YNYCKD KR    L  EC
Sbjct:   63 LTIWLDRTSGSGFKSVKPFRSGYFGANIKLQPGYTAGVITSLYLSNNEAHPGFH-DEVDIEFLGTTFGKPYTLQTNVYIRGSGDGKIIGREMKFRLWFDPTKDFHHYAILWSPREIIFLVDDIPIRRYP--KKSASTFPL-RPMWLYGSIWDASSWATEDGKYKADYKYQPFTAKYTNFKALGCT-AYSSARCYPLSASPYRSGGLTRQQHQAMRWVQTHSMVYNYCKDYKR-DHSLTPEC 297          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH30_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 30 OS=Arabidopsis thaliana GN=XTH30 PE=2 SV=2)

HSP 1 Score: 167.162 bits (422), Expect = 1.115e-40
Identity = 87/240 (36.25%), Postives = 136/240 (56.67%), Query Frame = 2
Query:   29 LSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPG---STWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDR--EQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFSQELD-----TXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            L LD+ +GSGF S + Y  G     +KL    +AG V A+Y  +      T DE+D EFLGN+ G P+   TN++ NG   R  E+++ LWFDP+ +FH YS+LW P +I+F+VD  PIRE    ++ G  +P  +PM +Y+++W+A DWAT GG  K ++  APF A +++F+ + C                 F +  D     +  +  ++  ++ +M Y+YC D+ R+P+ LP EC
Sbjct:   56 LLLDRYTGSGFISSNMYQHGFYSSMIKLPADYTAGVVVAFYTSNGDVFEKTHDELDIEFLGNIKGKPWRFQTNLYGNGSTHRGREERYRLWFDPSKEFHRYSILWTPHKIIFWVDDVPIREVIRNDAMGADYPA-KPMALYATIWDASDWATSGGKYKANYKFAPFVAEFKSFSLDGCSVDPIQEVPMDCSDSVDFLESQDYSSINSHQRAAMRRFRQRFMYYSYCYDTLRYPEPLP-EC 293          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH28_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 28 OS=Arabidopsis thaliana GN=XTH28 PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 3.587e-39
Identity = 89/247 (36.03%), Postives = 133/247 (53.85%), Query Frame = 2
Query:   11 NGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPG---STWDEIDFEFLGNLSGDPYTLHTNVFTNGKGD--REQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPW---FSQELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKECAFN 727
            +G+ + L+LD+ +GSGF S   YL G     +KL    SAG V A+YL +        DEIDFEFLGN+ G  + + TN++ NG     RE++++LWFDPT DFH YS+LW+   I+FYVD  PIRE K   S G  FP  +PM +YS++W+   WAT GG    ++  AP+ + + +   + C                     + E+    + +++  ++ +M Y+YC D  R+   L  EC  N
Sbjct:   49 DGKSVRLTLDERTGSGFVSNDIYLHGFFSSSIKLPADYSAGVVIAFYLSNGDLYEKNHDEIDFEFLGNIRGREWRIQTNIYGNGSTHLGREERYNLWFDPTEDFHQYSILWSLSHIIFYVDNVPIREVKRTASMGGDFPA-KPMSLYSTIWDGSKWATDGGKYGVNYKYAPYVSQFTDLILHGCAVDPTEKFPSCKDEAVQNLRLASEITESQRNKMEIFRQKHMTYSYCYDHMRYKVVL-SECVVN 293          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH33_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 33 OS=Arabidopsis thaliana GN=XTH33 PE=2 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 1.044e-38
Identity = 86/253 (33.99%), Postives = 135/253 (53.36%), Query Frame = 2
Query:   11 NGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGS---TWDEIDFEFLGNLSGDPYTLHTNVFTNG--KGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANAC---------VWXXXXXXXXXXXXXPWFSQELDTXGQERLK---WVQKNYMIYNYCKDSKRFPQGLPKEC 718
            NG L  L+LDK+SG+G  SK++Y +G    +LKL  G ++G V A+YL +  +   + DEID E LG    D +T+ TNV+ NG  +  RE++F+ WFDPT  FH Y+++WN    VF VD  P+R+F N  +    +P ++PM +Y ++W+  +WAT+GG    ++  APF  S  +   + C                        P   Q+  T  + ++    W ++  M Y+YC D  R+ + +P EC
Sbjct:   59 NGSLAKLTLDKSSGAGLVSKNKYHYGFFSARLKLPAGFASGVVVAFYLSNAETYPKSHDEIDIELLGRSRRDDWTIQTNVYANGSTRTGREEKFYFWFDPTQAFHDYTLIWNSHHTVFLVDNIPVRQFPNRGAFTSAYP-SKPMSLYVTVWDGSEWATKGGKYPVNYKYAPFVVSVADVELSGCSVNNGSSTGSGPCTKSGGSISSLDPVDGQDFATLSKNQINAMDWARRKLMFYSYCSDKPRY-KVMPAEC 309          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH27_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 27 OS=Arabidopsis thaliana GN=XTH27 PE=2 SV=2)

HSP 1 Score: 157.147 bits (396), Expect = 1.154e-37
Identity = 85/247 (34.41%), Postives = 131/247 (53.04%), Query Frame = 2
Query:   11 NGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPG---STWDEIDFEFLGNLSGDPYTLHTNVFTNGK--GDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXP---WFSQELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKECAFN 727
            +G+ + L+LD+ +GSGF S   YL G     +KL    +AG V A+Y+ +        DEIDFEFLGN+    + + TN++ NG     RE++++LWFDPT DFH YS+LW+   I+F+VD  PIRE K     G  FP ++PM +Y+++W+   WAT GG    ++  AP+ A + +   + C                     +QE+    + ++   ++  M Y+YC D  R+   L  EC  N
Sbjct:   49 DGKSVRLTLDERTGSGFVSNDYYLHGFFSASIKLPSDYTAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIREKEWRVQTNIYGNGSTHSGREERYNLWFDPTEDFHQYSILWSDSHIIFFVDNVPIREVKRTAEMGGHFP-SKPMSLYTTIWDGSKWATNGGKYGVNYKYAPYIARFSDLVLHGCPVDPIEQFPRCDEGAAEDMRAAQEITPSQRSKMDVFRRRLMTYSYCYDRARYNVAL-SECVVN 293          
The following BLAST results are available for this feature:
BLAST of DC899998 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 54
Match NameE-valueIdentityDescription
XTH10_ARATH4.970e-6547.11Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH2_ARATH2.553e-6147.97Xyloglucan endotransglucosylase/hydrolase protein ... [more]
XTH1_ARATH6.507e-5745.71Putative xyloglucan endotransglucosylase/hydrolase... [more]
XTH3_ARATH2.473e-5645.27Xyloglucan endotransglucosylase/hydrolase protein ... [more]
XTH31_ARATH4.994e-4943.78Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH32_ARATH3.579e-4742.74Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH30_ARATH1.115e-4036.25Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH28_ARATH3.587e-3936.03Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH33_ARATH1.044e-3833.99Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH27_ARATH1.154e-3734.41Probable xyloglucan endotransglucosylase/hydrolase... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899998 VSS Citrus sinensis cDNA clone VS27Q09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899998 ID=DC899998|Name=DC899998|organism=Citrus sinensis|type=EST|length=870bp
GATACTCAACAACGGCCAGCTTCTCTCCCTCTCCCTTGACAAAGCCTCAG
GCTCAGGCTTCCAGTCCAAGAGCGAGTACCTTTTTGGCAAAATCGACATG
CAACTCAAGCTTGTCCCTGGCAATTCTGCCGGCACAGTCACCGCCTACTA
CTTAAAATCACCAGGATCAACATGGGATGAGATAGACTTTGAATTCTTGG
GGAATTTAAGTGGTGATCCTTATACTCTTCATACTAATGTGTTCACAAAT
GGCAAAGGTGACAGAGAGCAACAATTCCACCTCTGGTTTGACCCCACTGC
TGACTTTCACACCTATTCCGTTCTCTGGAACCCCCAACGTATTGTCTTCT
ATGTTGATGGCTCGCCAATTAGAGAGTTCAAGAACTTGGAATCAAACGGC
GTACTCTTTCCCAAAAACCAGCCGATGAGGATTTACTCGAGTCTCTGGAA
CGCCGATGACTGGGCCACGAGAGGTGGCCTTATCAAAACTGACTGGACCC
AAGCTCCCTTCACTGCTTCTTACAGAAACTTCAATGCCAATGCTTGCGTC
TGGTCTAATGGAAAATCCTCTTGCAACTCAAAAAATAATAATCCATGGTT
CTCGCAAGAACTTGATACCNCTGGCCAAGAGAGACTCAAATGGGTGCAGA
AGAATTACATGATATATAATTATTGCAAGGACTCAAAACGATTTCCCCAA
GGGCTCCCAAAAGAATGTGCATTCAATATATAACTGATCCATTTGCCATA
TGTCTTTGTTTATAGCTTTTTTAATCTTCAGTTTTGATGTTTTGGTTCTT
TTATTCTGTGTACTAATGTTTAGTGACAAATAAAATGTATGGTTCATTCT
TTTTTGTACTATAAGTGCTA
back to top