DC899998

Overview
NameDC899998
Unique NameDC899998
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length870
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2224 contig Csv1_Contig2224:197..1066. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH11_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 11 OS=Arabidopsis thaliana GN=XTH11 PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 7.479e-37
Identity = 85/239 (35.56%), Postives = 134/239 (56.07%), Query Frame = 2
Query:    2 ILNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFSQELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            ++N    L L+LDK SGSGF+S+  Y  G  ++++K     S G +T++YL S  S  DE+ F+ LG  +G PY L+TN++  G+G ++Q+F LWFDPT D+H+YS LWNP ++VFYVD +PIR +   ++  V +P  Q M +  S+ N       G +I  D  Q P+ A ++      C                W  ++L +  +      +K Y+ Y+YC D +R+P+ +P+EC
Sbjct:   38 VINKTSELQLTLDKNSGSGFESQLIYGSGYFNVRIKAPQTTSTGVITSFYLISRSSRHDELCFQILGK-NGPPYLLNTNMYLYGEGGKDQRFRLWFDPTKDYHSYSFLWNPNQLVFYVDDTPIRVYS--KNPDVYYPSVQTMFLMGSVQN-------GSII--DPKQMPYIAKFQASKIEGCKTEFMGIDKCTDPKFWWNRKQLSSKEKTLYLNARKTYLDYDYCSDRQRYPK-VPQEC 263          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH29_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 29 OS=Arabidopsis thaliana GN=XTH29 PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 3.142e-35
Identity = 75/179 (41.90%), Postives = 109/179 (60.89%), Query Frame = 2
Query:   29 LSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTW----DEIDFEFLGNLSGDPYTLHTNVFTNGKGDR--EQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANAC 547
            L LDK +GSGF S S Y  G     +KL    +AG V A+Y  S G  +    DE+D EFLGNL G P+   TN++ NG  +R  E+++ LWFDP+ +FH YS+LW P +I+F+VD  PIRE    E     +P+ +PM +Y+++W+A  WAT GG    D+T +PF + +++   + C
Sbjct:   64 LLLDKYTGSGFISSSMYQHGFFSSLIKLPGAYTAGIVVAFYT-SNGDVFVKDHDELDIEFLGNLEGKPWRFQTNMYGNGSTNRGREERYRLWFDPSKEFHRYSILWTPTKIIFWVDDVPIREILRKEEMNGDYPQ-KPMSLYATIWDASSWATSGGKFGVDYTFSPFVSEFKDIALDGC 240          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: CRR1_YEAST (Probable glycosidase CRR1 OS=Saccharomyces cerevisiae GN=CRR1 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.766e-15
Identity = 64/194 (32.99%), Postives = 96/194 (49.48%), Query Frame = 2
Query:    8 NNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGD--REQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLE-----SNGVLFPKNQPMRIYSSLW---------NADDWATRGGLIKTDWTQAPFTASYRNFNAN 541
            ++G ++     K +GS   S   +L+GK  +++K     S G VTA+ L S  +  DEIDFE+LG   GD  T  +N ++ G  D  R Q+F +  D  A +HTY + W+P RI++YVDG   R     +     S    +P+  PMR+  ++W            +WA  GGLI  DW  +P       F A+
Sbjct:  164 SSGNIVLAMPKKTTGSLITSTRSFLYGKASVRMKTA--RSRGVVTAFDLTS--AIGDEIDFEWLG---GDLMTAQSNYYSQGHLDYTRMQRFPVGADTWATYHTYEIDWDPDRIIWYVDGKIARTVLKKDTWDPISKEYRYPQT-PMRLEIAVWPGGSETNGPGTINWA--GGLI--DWENSPDIIEKGQFTAH 345          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: GUB_ORPSP (Beta-glucanase OS=Orpinomyces sp. (strain PC-2) GN=licA PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 3.993e-14
Identity = 54/163 (33.13%), Postives = 84/163 (51.53%), Query Frame = 2
Query:   11 NGQLLSLSLDKASGSGF-----QSKSEYLFGKIDMQLKLVPGNSAGTVTAYYL---KSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPI-REFKNLESNGVLFPKNQPMRIYSSLWN---ADDW 463
            NG+L  L++D+  GSG+     ++K+ Y +G   + +K  P  + G V++++     S G+ WDEID EFLG    D   +  N +TNG+G  E   +L FD +  FHTY   W    I +YVDG+ +   + N+         + P +I  + WN    DDW
Sbjct:   74 NGKL-KLTIDR-DGSGYTCGEYRTKNYYGYGMFQVNMK--PIKNPGVVSSFFTYTGPSDGTKWDEIDIEFLGY---DTTKVQFNYYTNGQGHHEHIHYLGFDASQGFHTYGFFWARNSITWYVDGTAVYTAYDNI--------PDTPGKIMMNAWNGIGVDDW 221          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: GUB_PAEPO (Beta-glucanase OS=Paenibacillus polymyxa GN=gluB PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 6.812e-14
Identity = 54/163 (33.13%), Postives = 81/163 (49.69%), Query Frame = 2
Query:    8 NNGQLLSLSLDKASGSGF-----QSKSEYLFGKIDMQLKLVPGNSAGTVTAYYL---KSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWN---ADDW 463
            N+G+L  LSL   + + F     +S + Y +G  ++ +K  P  + G V++++     S G+ WDEID EFLG    D   +  N +TNG G  E+  +L FD +  FHTY+  W P  I +YVDG        L+        + P +I  +LWN    D W
Sbjct:   67 NDGKL-KLSLTSPANNKFDCGEYRSTNNYGYGLYEVSMK--PAKNTGIVSSFFTYTGPSHGTQWDEIDIEFLGK---DTTKVQFNYYTNGVGGHEKIINLGFDASTSFHTYAFDWQPGYIKWYVDGV-------LKHTATTNIPSTPGKIMMNLWNGTGVDSW 216          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: GUB_PAEMA (Beta-glucanase OS=Paenibacillus macerans PE=1 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 8.897e-14
Identity = 50/154 (32.47%), Postives = 77/154 (50.00%), Query Frame = 2
Query:   20 LLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYL---KSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWN---ADDW 463
            L S + +K   + ++S + Y +G  ++ +K  P  + G V++++     + G+ WDEID EFLG    D   +  N +TNG G  E+   L FD +  FHTY+  W P  I +YVDG        L+        + P +I  +LWN    DDW
Sbjct:   74 LTSSAYNKFDCAEYRSTNIYGYGLYEVSMK--PAKNTGIVSSFFTYTGPAHGTQWDEIDIEFLGK---DTTKVQFNYYTNGVGGHEKVISLGFDASKGFHTYAFDWQPGYIKWYVDGV-------LKHTATANIPSTPGKIMMNLWNGTGVDDW 215          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: GUB_CLOTH (Beta-glucanase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237) GN=licB PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 8.897e-14
Identity = 55/167 (32.93%), Postives = 82/167 (49.10%), Query Frame = 2
Query:    8 NNGQLLSLSLDKASGSGFQSKS-EY----LFGKIDMQLKLVPGNSAGTVTAYYL---KSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPI-REFKNLESNGVLFPKNQPMRIYSSLW---NADDWATR 472
            +NG+++ L+LD+  G  +  KS EY     FG    ++++    + G V++++     S  + WDEID EFLG    D   +  N + NG G  E   +L FD + DFHTY   W P  I FYVDG  + R  +N+           P +I  +LW     D+W  R
Sbjct:   72 SNGKMI-LTLDREYGGSYPYKSGEYRTKSFFGYGYYEVRMKAAKNVGIVSSFFTYTGPSDNNPWDEIDIEFLGK---DTTKVQFNWYKNGVGGNEYLHNLGFDASQDFHTYGFEWRPDYIDFYVDGKKVYRGTRNIPVT--------PGKIMMNLWPGIGVDEWLGR 226          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: GUB_BACSU (Beta-glucanase OS=Bacillus subtilis GN=bglS PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 3.381e-13
Identity = 46/140 (32.86%), Postives = 73/140 (52.14%), Query Frame = 2
Query:   62 QSKSEYLFGKIDMQLKLVPGNSAGTVTAYYL---KSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWN---ADDW 463
            +S   Y +G  ++++K  P  + G V++++     + G+ WDEID EFLG    D   +  N +TNG G+ E+   L FD    +HTY+  W P  I +YVDG    + K+  +N +      P +I  +LWN    D+W
Sbjct:   93 RSVQTYGYGLYEVRMK--PAKNTGIVSSFFTYTGPTDGTPWDEIDIEFLGK---DTTKVQFNYYTNGAGNHEKIVDLGFDAANAYHTYAFDWQPNSIKWYVDG----QLKHTATNQI---PTTPGKIMMNLWNGTGVDEW 220          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: GUB_BACLI (Beta-glucanase OS=Bacillus licheniformis GN=bg1 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 4.415e-13
Identity = 49/154 (31.82%), Postives = 74/154 (48.05%), Query Frame = 2
Query:   20 LLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYL---KSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWN---ADDW 463
            L S S +K      +S   Y +G  ++ +K  P  + G V++++     + G+ WDEID EFLG    D   +  N +TNG G+ E+  +L FD    +HTY+  W P  I +YVDG        L+          P +I  +LWN    D+W
Sbjct:   80 LTSPSYNKFDCGENRSVQTYGYGLYEVNMK--PAKNVGIVSSFFTYTGPTDGTPWDEIDIEFLGK---DTTKVQFNYYTNGVGNHEKIVNLGFDAANSYHTYAFDWQPNSIKWYVDG-------QLKHTATTQIPQTPGKIMMNLWNGAGVDEW 221          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: GUB_BACAM (Beta-glucanase OS=Bacillus amyloliquefaciens GN=bglA PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 5.767e-13
Identity = 50/154 (32.47%), Postives = 74/154 (48.05%), Query Frame = 2
Query:   20 LLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYL---KSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWN---ADDW 463
            L S S +K      +S   Y +G  ++++K  P  + G V++++     + G+ WDEID EFLG    D   +  N +TNG G+ E+   L FD    +HTY+  W P  I +YVDG        L+          P +I  +LWN    DDW
Sbjct:   76 LTSPSYNKFDCGENRSVQTYGYGLYEVRMK--PAKNTGIVSSFFTYTGPTEGTPWDEIDIEFLGK---DTTKVQFNYYTNGAGNHEKFADLGFDAANAYHTYAFDWQPNSIKWYVDG-------QLKHTATTQIPAAPGKIMMNLWNGTGVDDW 217          
The following BLAST results are available for this feature:
BLAST of DC899998 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 54
Match NameE-valueIdentityDescription
XTH11_ARATH7.479e-3735.56Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH29_ARATH3.142e-3541.90Probable xyloglucan endotransglucosylase/hydrolase... [more]
CRR1_YEAST2.766e-1532.99Probable glycosidase CRR1 OS=Saccharomyces cerevis... [more]
GUB_ORPSP3.993e-1433.13Beta-glucanase OS=Orpinomyces sp. (strain PC-2) GN... [more]
GUB_PAEPO6.812e-1433.13Beta-glucanase OS=Paenibacillus polymyxa GN=gluB P... [more]
GUB_PAEMA8.897e-1432.47Beta-glucanase OS=Paenibacillus macerans PE=1 SV=2[more]
GUB_CLOTH8.897e-1432.93Beta-glucanase OS=Clostridium thermocellum (strain... [more]
GUB_BACSU3.381e-1332.86Beta-glucanase OS=Bacillus subtilis GN=bglS PE=1 S... [more]
GUB_BACLI4.415e-1331.82Beta-glucanase OS=Bacillus licheniformis GN=bg1 PE... [more]
GUB_BACAM5.767e-1332.47Beta-glucanase OS=Bacillus amyloliquefaciens GN=bg... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899998 VSS Citrus sinensis cDNA clone VS27Q09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899998 ID=DC899998|Name=DC899998|organism=Citrus sinensis|type=EST|length=870bp
GATACTCAACAACGGCCAGCTTCTCTCCCTCTCCCTTGACAAAGCCTCAG
GCTCAGGCTTCCAGTCCAAGAGCGAGTACCTTTTTGGCAAAATCGACATG
CAACTCAAGCTTGTCCCTGGCAATTCTGCCGGCACAGTCACCGCCTACTA
CTTAAAATCACCAGGATCAACATGGGATGAGATAGACTTTGAATTCTTGG
GGAATTTAAGTGGTGATCCTTATACTCTTCATACTAATGTGTTCACAAAT
GGCAAAGGTGACAGAGAGCAACAATTCCACCTCTGGTTTGACCCCACTGC
TGACTTTCACACCTATTCCGTTCTCTGGAACCCCCAACGTATTGTCTTCT
ATGTTGATGGCTCGCCAATTAGAGAGTTCAAGAACTTGGAATCAAACGGC
GTACTCTTTCCCAAAAACCAGCCGATGAGGATTTACTCGAGTCTCTGGAA
CGCCGATGACTGGGCCACGAGAGGTGGCCTTATCAAAACTGACTGGACCC
AAGCTCCCTTCACTGCTTCTTACAGAAACTTCAATGCCAATGCTTGCGTC
TGGTCTAATGGAAAATCCTCTTGCAACTCAAAAAATAATAATCCATGGTT
CTCGCAAGAACTTGATACCNCTGGCCAAGAGAGACTCAAATGGGTGCAGA
AGAATTACATGATATATAATTATTGCAAGGACTCAAAACGATTTCCCCAA
GGGCTCCCAAAAGAATGTGCATTCAATATATAACTGATCCATTTGCCATA
TGTCTTTGTTTATAGCTTTTTTAATCTTCAGTTTTGATGTTTTGGTTCTT
TTATTCTGTGTACTAATGTTTAGTGACAAATAAAATGTATGGTTCATTCT
TTTTTGTACTATAAGTGCTA
back to top