DC899996

Overview
NameDC899996
Unique NameDC899996
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length996
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1834 contig Csv1_Contig1834:292..1287. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: APG_ARATH (Anter-specific proline-rich protein APG OS=Arabidopsis thaliana GN=APG PE=2 SV=2)

HSP 1 Score: 159.458 bits (402), Expect = 2.877e-38
Identity = 92/282 (32.62%), Postives = 144/282 (51.06%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKL----------AKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G +A+D+ A  +G K   PAYL P+    +LL G +FAS G+GY+  TS   +AI +  QL Y+++Y  K+           K+AG +++  +I   + IV  GS D +  Y+ +         + Y++++ +  +SF+  +YG GAR+ GV   PPLGC+P+ R      +  C   +N  +Q FN K+      L K LP+   V  DI+  I  ++++P+  GF E K+             LC   +   C N S Y+FWD VHP+Q A + I   LI
Sbjct:  248 GMVASDYLAKYMGVKEIVPAYLDPKIQPNDLLTGVSFASGGAGYNPTTSEAANAIPMLDQLTYFQDYIEKVNRLVRQEKSQYKLAGLEKTNQLISKGVAIVVGGSNDLIITYFGSGAQRLKNDIDSYTTIIADSAASFVLQLYGYGARRIGVIGTPPLGCVPSQRL---KKKKICNEELNYASQLFNSKLLLILGQLSKTLPNSTFVYMDIYTIISQMLETPAAYGFEETKKPCCKTGLLSAGA-LCKKSTSKICPNTSSYLFWDGVHPTQRAYKTINKVLI 525          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: APG_BRANA (Anther-specific proline-rich protein APG (Fragment) OS=Brassica napus GN=APG PE=2 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 4.908e-38
Identity = 90/278 (32.37%), Postives = 144/278 (51.80%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKN------LLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G++A+D+ +  LG K   PAY+  +    N      LL G +FAS G+GY  +TS      ++  QL Y+++Y+ ++ K+ G K++  I+     IV AGS D +  Y+ N   +     + +++M+ +  +SF+  +YG GAR+ GV   PP+GC P+ R      +  C   +N  AQ FN K+      L K LP+  IV  DI+     +++SP   GF E K+            F C  ++    SNAS Y+FWD +HPSQ A ++   +L+
Sbjct:  169 GRVASDYISKYLGVKEIVPAYVDKKLQQNNELQQSDLLTGVSFASGGAGYLPQTSESWKVTTMLDQLTYFQDYKKRMKKLVGKKKTKKIVSKGAAIVVAGSNDLIYTYFGNGAQHLKNDVDSFTTMMADSAASFVLQLYGYGARRIGVIGTPPIGCTPSQRV---KKKKICNEDLNYAAQLFNSKLVIILGQLSKTLPNSTIVYGDIYSIFSKMLESPEDYGFEEIKKPCCKIGLTKGGVF-CKERTLKNMSNASSYLFWDGLHPSQRAYEISNRKLV 442          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: EXL6_ARATH (GDSL esterase/lipase EXL6 OS=Arabidopsis thaliana GN=EXL6 PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 4.593e-36
Identity = 92/278 (33.09%), Postives = 144/278 (51.80%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLS-PQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSAS-IIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATN--LQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQ 822
            G++ TD  A+ L  K   PAY    + + ++L  G  FAS GSG DD TS     +S   Q++ +++Y  KL +V   K+    I+ +A++++  G+ D    Y+V P L ++ +   Y+S +V     F+K++Y LGARKF V  + P+GCLP  R  FG     C   +N   + FN K+    T+  ++    D K V  DI+  + DLV++P   GF EAK+              C P +   C +  +YVF+D  HPSQ A +VI+  ++ Q
Sbjct:   73 GRVFTDIVAEGLQIKRLVPAYSKIRRISSEDLKTGVCFASGGSGIDDLTSRTLRVLSAGDQVKDFKDYLKKLRRVVKRKKKVKEIVSNAVFLISEGNNDL--GYFVAPALLRLQSTTTYTSKMVVWTRKFLKDLYDLGARKFAVMGVMPVGCLPIHRASFGGVFGWCNFLLNRITEDFNMKLQKGLTSYAVEYDFKDAKFVYVDIYGTLMDLVKNPMAYGFTEAKKAC-----------CCMPNAIIPCFHPDKYVFYDFAHPSQKAYEVISKPIVYQ 337          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL56_ARATH (GDSL esterase/lipase At3g43570 OS=Arabidopsis thaliana GN=At3g43570 PE=3 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 1.336e-35
Identity = 87/272 (31.99%), Postives = 139/272 (51.10%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G++ +D  A+ +G     PAY++P    ++LL G  FAS G+GYD  T+ +   IS+  QL Y++EY SK+ +  G +++  I++ + ++V + S D    Y         Y    Y++ L +    F++ ++ LGA+K GV S  P+GC+P  RT+FG                             K+L D  I+  +++  ++D++Q P K GF  A R            +LCN  +  TCSN+S Y+FWDS HPS+ A QVI D L+
Sbjct:   74 GRVPSDLIAEKIGLAKTLPAYMNPYLKPEDLLKGVTFASGGTGYDPLTAKIMSVISVWDQLIYFKEYISKIKRHFGEEKAKDILEHSFFLVVSSSNDLAHTYLAQA---HRYDRTSYANFLADSAVHFVRELHKLGAQKIGVFSAVPVGCVPLQRTVFG----------------------------DKEL-DGVILYINVYDTLFDMIQHPKKYGFEVADRGCCGKGLLTIS-YLCNSLNQFTCSNSSAYIFWDSYHPSKRAYQVIVDNLL 312          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL15_ARATH (GDSL esterase/lipase At1g29670 OS=Arabidopsis thaliana GN=At1g29670 PE=2 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.746e-35
Identity = 91/273 (33.33%), Postives = 146/273 (53.48%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTS-YLNHAISLTQQLQYYREYQSKLAKVAGSK-QSASIIKDAIYIVGAGSGDFLQNYYVNPLLN--KVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHES-GCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIA 804
            GK   D  A+ LGF  Y PAY +   +G+ +L G N+ASA +G  + T   L   IS + Q++ Y+   S++ ++ G + ++A  +K  IY VG GS D+L NY++    +  + +TPEQY++ L++ +S+ +  +Y  GARKF ++ +  +GC P A  L G  +   CV RIN+  Q FN K+ S    L    PD K +  + +    D++ +P++ GF                   C P     C + + YVFWD+ HP++AAN +IA
Sbjct:   74 GKTTVDVIAELLGFNGYIPAYNT--VSGRQILSGVNYASAAAGIREETGRQLGQRISFSGQVRNYQTTVSQVVQLLGDETRAADYLKRCIYSVGLGSNDYLNNYFMPTFYSSSRQFTPEQYANDLISRYSTQLNALYNYGARKFALSGIGAVGCSPNA--LAGSPDGRTCVDRINSANQIFNNKLRSLVDQLNNNHPDAKFIYINAYGIFQDMITNPARFGF-RVTNAGCCGIGRNAGQITCLP-GQRPCRDRNAYVFWDAFHPTEAANVIIA 340          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL64_ARATH (GDSL esterase/lipase At4g16230 OS=Arabidopsis thaliana GN=At4g16230 PE=2 SV=2)

HSP 1 Score: 148.288 bits (373), Expect = 6.633e-35
Identity = 86/276 (31.16%), Postives = 135/276 (48.91%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYL-NHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYY---VNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G+   D     LG     P YL+P  +G  +L G N+AS GSG  + T  L    I++  QL  +   +  +    G  ++A + + AI+ V  GS D + NY+   ++ L  KV  PE +   +++ F   +  +Y LGARK  V ++ P+GC+P  R       + C++  N  AQ +N K+ +    L K L   + V  D+F+ + D++Q+ S  GF   K               C P S   C + S+YVFWD  HP++AAN +IA  L+
Sbjct:   72 GRTIVDIVYQALGSDELTPPYLAPTTSGSLILNGVNYASGGSGILNSTGKLFGERINVDAQLDNFATTRQDIISWIGESEAAKLFRSAIFSVTTGSNDLINNYFTPVISTLQRKVVAPEVFVDTMISKFRLQLTRLYQLGARKIVVINIGPIGCIPFERESDPAAGNNCLAEPNEVAQMYNLKLKTLVEELNKNLQGSRFVYGDVFRIVDDIIQNYSSYGFESEKIPCCSLVGKVGGLIPCGPPSK-VCMDRSKYVFWDPYHPTEAANIIIARRLL 346          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL14_ARATH (GDSL esterase/lipase At1g29660 OS=Arabidopsis thaliana GN=At1g29660 PE=2 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 4.299e-34
Identity = 85/272 (31.25%), Postives = 135/272 (49.63%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRT-SYLNHAISLTQQLQYYREYQSKLAKVAGSKQSAS-IIKDAIYIVGAGSGDFLQNYYVNPLLN--KVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIA 804
            G+   D   + LGF  Y PAY +   +G+ +L G N+ASA +G  + T + L   I+ + Q++ Y+   +++ ++ G + +A+  +K  IY VG GS D+L NY++    +  + YTPEQY+  L++ +   +  +Y  GARKF +  +  +GC P A        + CV RIN+  + FN ++ S    L     D      + +    D++ +PS  GF                   C P  P  C N  +YVFWD+ HPS AAN  IA
Sbjct:   74 GRTTVDVLTELLGFDNYIPAYST--VSGQEILQGVNYASAAAGIREETGAQLGQRITFSGQVENYKNTVAQVVEILGDEYTAADYLKRCIYSVGMGSNDYLNNYFMPQFYSTSRQYTPEQYADDLISRYRDQLNALYNYGARKFALVGIGAIGCSPNALAQGSQDGTTCVERINSANRIFNNRLISMVQQLNNAHSDASFTYINAYGAFQDIIANPSAYGFTNT-NTACCGIGRNGGQLTCLPGEP-PCLNRDEYVFWDAFHPSAAANTAIA 341          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: EXL5_ARATH (GDSL esterase/lipase EXL5 OS=Arabidopsis thaliana GN=EXL5 PE=2 SV=2)

HSP 1 Score: 141.354 bits (355), Expect = 8.108e-33
Identity = 84/267 (31.46%), Postives = 134/267 (50.19%), Query Frame = 1
Query:   22 TADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQ--KQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            +A+ LG K   PAY        +L  G +FAS G+G D  TS L   +S   Q++ ++ Y+ KL  V G  ++  I+ +++ +V  G+ D    Y ++    ++ TP+ Y+S LV     FIK++Y  GARKF V  + PLGCLP +R +FG     C    NT ++ +NKK+ S   + +        + V  D++  + D++ +  K GF   K               C   +   CSN  +YVF+D  HPS+ A + IA +L+
Sbjct:   95 SAEGLGIKRIVPAYRKLYIAPSDLKTGVSFASGGAGVDPVTSKLLRVLSPADQVKDFKGYKRKLKGVVGRSKAKKIVANSVILVSEGNNDIGITYAIHDAGMRLMTPKVYTSKLVGWNKKFIKDLYDHGARKFAVMGVIPLGCLPMSRLIFGGFFVWCNFLANTISEDYNKKLKSGIKSWRGASDFRGARFVYVDMYNSLMDVINNHRKYGFTHEKNGC-----------CCMLTAIVPCSNPDKYVFYDFAHPSEKAYKTIAKKLV 350          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL38_ARATH (GDSL esterase/lipase At2g23540 OS=Arabidopsis thaliana GN=At2g23540 PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 2.359e-32
Identity = 83/278 (29.86%), Postives = 138/278 (49.64%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLN-HAISLTQQLQYYREYQSKLAKVAGSKQSASII-KDAIYIVGAGSGDFLQNYYVNPLLNK----VYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G+   D   + LG   YA  +L+P A GK LL G N+AS G G  + T  +  + + +  Q+ ++   + +   + G +++   I K +I+ +  G+ DFL NY   PLL+       TP+ +   ++      +  +Y L ARKF + ++ P+GC+P  +T+    E+ CV   N  A Q+N ++ S    L K+LP    V  +++  + +L+ +  K GF  A +              C P S   C    +YVFWD  HPS+AAN +IA +L+
Sbjct:   94 GRTIGDIVGEELGSANYAIPFLAPDAKGKALLAGVNYASGGGGIMNATGRIFVNRLGMDVQVDFFNTTRKQFDDLLGKEKAKDYIAKKSIFSITIGANDFLNNYLF-PLLSVGTRFTQTPDDFIGDMLEHLRDQLTRLYQLDARKFVIGNVGPIGCIPYQKTINQLDENECVDLANKLANQYNVRLKSLLEELNKKLPGAMFVHANVYDLVMELITNYDKYGFKSATKACCGNGGQYAGIIPCGPTS-SLCEERDKYVFWDPYHPSEAANVIIAKQLL 369          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL58_ARATH (GDSL esterase/lipase At3g50400 OS=Arabidopsis thaliana GN=At3g50400 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 4.024e-32
Identity = 84/278 (30.22%), Postives = 143/278 (51.44%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRT-SYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASII-KDAIYIVGAGSGDFLQNY---YVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAAT-NLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G+   D   + LG ++YA  YL+P A+G+ LL G N+AS G G  + T S   + + +  Q+ Y+   + +  K+ G  ++   I K +++ V  GS DFL NY   +V        TPE +   +++   + +K +Y + ARKF V ++ P+GC+P  +++   ++  CV   N  A Q+N ++    T  L+  L D   V  +++    DL+ +    GF  A                C P S   C++ S++VFWD+ HP++AAN +IAD+L+
Sbjct:   80 GRTIADIVGEKLGQQSYAVPYLAPNASGEALLNGVNYASGGGGILNATGSVFVNRLGMDIQVDYFTNTRKQFDKLLGQDKARDYIRKRSLFSVVIGSNDFLNNYLVPFVAAQARLTQTPETFVDDMISHLRNQLKRLYDMDARKFVVGNVAPIGCIPYQKSINQLNDKQCVDLANKLAIQYNARLKDLLTVELKDSLKDAHFVYANVYDLFMDLIVNFKDYGFRTASEACCETRGRLAGILPCGPTS-SLCTDRSKHVFWDAYHPTEAANLLIADKLL 356          
The following BLAST results are available for this feature:
BLAST of DC899996 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 96
Match NameE-valueIdentityDescription
APG_ARATH2.877e-3832.62Anter-specific proline-rich protein APG OS=Arabido... [more]
APG_BRANA4.908e-3832.37Anther-specific proline-rich protein APG (Fragment... [more]
EXL6_ARATH4.593e-3633.09GDSL esterase/lipase EXL6 OS=Arabidopsis thaliana ... [more]
GDL56_ARATH1.336e-3531.99GDSL esterase/lipase At3g43570 OS=Arabidopsis thal... [more]
GDL15_ARATH1.746e-3533.33GDSL esterase/lipase At1g29670 OS=Arabidopsis thal... [more]
GDL64_ARATH6.633e-3531.16GDSL esterase/lipase At4g16230 OS=Arabidopsis thal... [more]
GDL14_ARATH4.299e-3431.25GDSL esterase/lipase At1g29660 OS=Arabidopsis thal... [more]
EXL5_ARATH8.108e-3331.46GDSL esterase/lipase EXL5 OS=Arabidopsis thaliana ... [more]
GDL38_ARATH2.359e-3229.86GDSL esterase/lipase At2g23540 OS=Arabidopsis thal... [more]
GDL58_ARATH4.024e-3230.22GDSL esterase/lipase At3g50400 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899996 VSS Citrus sinensis cDNA clone VS27Q07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899996 ID=DC899996|Name=DC899996|organism=Citrus sinensis|type=EST|length=996bp
GGGAAATTAGCCACTGACTTCACTGCTGATACCCTAGGCTTTAAGACTTA
TGCGCCAGCATATCTCAGTCCACAGGCTACAGGGAAAAACCTCCTTATTG
GAGCCAACTTTGCTTCAGCGGGATCTGGTTATGATGACAGGACATCCTAC
TTAAATCATGCAATTTCATTGACTCAGCAGTTGCAGTACTATAGAGAGTA
CCAGAGTAAGCTAGCAAAGGTAGCTGGTAGCAAACAATCAGCTTCCATAA
TCAAGGATGCGATATACATAGTGGGTGCTGGGAGTGGTGACTTTCTTCAG
AATTACTATGTCAATCCTTTACTTAACAAAGTCTACACTCCTGAGCAGTA
TAGCTCAATGCTTGTCAATATTTTCTCAAGTTTTATTAAGAACATGTATG
GATTGGGAGCAAGAAAATTTGGAGTGACTTCACTGCCACCATTGGGTTGC
CTTCCAGCAGCAAGAACTTTATTTGGATATCACGAGAGTGGCTGTGTCTC
TAGAATCAATACTGATGCTCAACAATTTAACAAGAAGGTCAGCTCCGCAG
CAACAAATCTTCAAAAGCAACTTCCTGATCTGAAAATTGTGATTTTCGAC
ATTTTCAAGCCAATCTATGACCTTGTCCAATCCCCTTCAAAATCTGGCTT
CGTGGAGGCAAAAAGAGGTTGCTGTGGAACAGGAACTGTAGAAACAACTG
TCTTTCTGTGCAATCCAAAGTCGCCTGGAACATGCTCCAATGCCTCTCAG
TATGTGTTCTGGGACAGTGTTCATCCTTCTCAGGCTGCTAATCAGGTTAT
TGCCGATGAATTGATTGTTCAAGGATTTGCCCTTCTCTGAAGGGGATGTC
AAATCCATGGAAATGATCAATATTTCTGTTGAGGCTTCTTAATCTTCTTG
GTGTCTGTGCTTCAGTTTATCTGCTTGTCTATACATCATTTTAAGATTTC
CTTTGTTTCTTCTAACATTTGCTATATATACATAGTGTTTTGCTAC
back to top