DC899996

Overview
NameDC899996
Unique NameDC899996
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length996
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1834 contig Csv1_Contig1834:292..1287. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL55_ARATH (GDSL esterase/lipase At3g43550 OS=Arabidopsis thaliana GN=At3g43550 PE=2 SV=2)

HSP 1 Score: 138.272 bits (347), Expect = 6.864e-32
Identity = 74/217 (34.10%), Postives = 123/217 (56.68%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLF-GYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSG 648
            G++ +D  A+ LG     PAY++P     +LL G  FAS G+GYD  T+ +   IS+  QL Y++EY SK+ +  G +++  I++ + ++V + S D    Y         Y    Y++ L +    F++ ++ LGARK GV S  P+GC+P  RT+F G+   GC   +N  A+QFN ++S A  +L K+L D  I+  +++  ++D++Q P K G
Sbjct:   74 GRVPSDLIAEKLGLVKTLPAYMNPYLKPHDLLKGVTFASGGTGYDPLTAKIMSVISVWDQLIYFKEYISKIKRHFGEEKAKDILEHSFFLVVSSSNDLAHTYLAQA---HRYDRTSYANFLADSAVHFVRELHKLGARKIGVFSAVPVGCVPLQRTVFGGFFTRGCNQPLNNMAKQFNARLSPALDSLDKEL-DGVIIYINVYDTLFDMIQHPKKYG 286          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: LTL1_ARATH (GDSL esterase/lipase LTL1 OS=Arabidopsis thaliana GN=LTL1 PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 8.965e-32
Identity = 80/272 (29.41%), Postives = 143/272 (52.57%), Query Frame = 1
Query:   16 DFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGY--DDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPL--LNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESG-CVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            D  ++ +G  +  P YLSP  TG+NLL+GANFASAG G   D    ++N  I +++Q++Y+ +YQ +++ + G + +  ++  A+ ++  G  DF+ NYY+ P    ++ Y    Y   L++ +   ++ +Y LGAR+  VT    +GC PA   L  +  +G C   + T A  FN ++     ++  ++     V  + ++   D + +P + GFV +K              LC P S   C N   Y FWD+ HP++ AN++I ++++
Sbjct:   78 DIISEAIGMPSTLP-YLSPHLTGENLLVGANFASAGIGILNDTGIQFVN-IIRISKQMEYFEQYQLRVSALIGPEATQQLVNQALVLITLGGNDFVNNYYLIPFSARSRQYALPDYVVYLISEYGKILRKLYELGARRVLVTGTGAMGCAPA--ELAQHSRNGECYGALQTAAALFNPQLVDLIASVNAEIGQDVFVAANAYQMNMDYLSNPEQFGFVTSK-VACCGQGPYNGIGLCTPVS-NLCPNRDLYAFWDAFHPTEKANRIIVNQIL 343          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: EXL4_ARATH (GDSL esterase/lipase EXL4 OS=Arabidopsis thaliana GN=EXL4 PE=1 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 8.391e-30
Identity = 83/275 (30.18%), Postives = 134/275 (48.73%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLN-KVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQ--LPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G++ +D  A+ LG K   PAY     +  +L  G  FAS G+G D  TS L   ++   Q+  ++ Y  KL   AG  +++SI+ +A+ +V  G+ D   +Y+  P    +  TP +Y++ L      F+K +Y  GARKF V  + PLGCLP  R   G     C    N  A+Q+N K+ S   +  ++      K V  D++  + D++++  + GF   K               C   +   C N  +YVF+D VHPS+ A + I+ +L+
Sbjct:   72 GRVFSDIVAEGLGIKKILPAYRKLFNSPSDLRTGVCFASGGAGVDPVTSKLLRVLTPKDQVNDFKGYIRKLKATAGPSRASSIVSNAVILVSQGNNDIGISYFGTPTAAFRGLTPNRYTTKLAGWNKQFMKELYDQGARKFAVMGVIPLGCLPMTRIFLGGFVITCNFFANRVAEQYNGKLRSGTKSWGREAGFRGAKFVYVDMYNTLMDVIKNYRRYGFSNEKNGC-----------CCMITAIIPCPNPDKYVFYDFVHPSEKAYRTISKKLV 335          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GLIP7_ARATH (GDSL esterase/lipase 7 OS=Arabidopsis thaliana GN=GLIP7 PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.431e-29
Identity = 86/281 (30.60%), Postives = 137/281 (48.75%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRT-------SYLNHAIS---LTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLN--KVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLF-GYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIA 804
            G+   D+ A  LG     P YLSP + G+N L G N+ASA +G  D T       +  N  IS   +T +L+  R +Q+              +  +I  +  GS D++ NY +    +  + Y+ E Y+ +L+   S+ I  +Y LGARK  +    PLGC+P+  ++  G + SGCV++IN     FN ++   A  L   LP    V  ++F   +D+V +PS+ G V +                   + P  C + +QYVFWD+ HP++ AN++IA
Sbjct:   72 GRTVVDYGATYLGLPL-VPPYLSPLSIGQNALRGVNYASAAAGILDETGRHYGARTTFNGQISQFEITIELRLRRFFQNPA-------DLRKYLAKSIIGINIGSNDYINNYLMPERYSTSQTYSGEDYADLLIKTLSAQISRLYNLGARKMVLAGSGPLGCIPSQLSMVTGNNTSGCVTKINNMVSMFNSRLKDLANTLNTTLPGSFFVYQNVFDLFHDMVVNPSRYGLVVSNEACCGNGRYGGALTCLPLQQP--CLDRNQYVFWDAFHPTETANKIIA 342          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL80_ARATH (GDSL esterase/lipase At5g37690 OS=Arabidopsis thaliana GN=At5g37690 PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 2.441e-29
Identity = 80/274 (29.20%), Postives = 131/274 (47.81%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTS-YLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLL--NKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADEL 813
            G+   D  +  LG  +  P YLS        L G N+AS G+G  + T  Y    ++   Q+  +++ +  +    G   +   + DA+Y +G GS D++ N+ + P +   + YT +++  +L +   + +  +Y LGARK     L PLGC+P+ R         C++R+N    +FN +      +L K+LP  K    D +  + DL+ +P+  GF  A               LC P S   C N   +VFWD+ HPS +ANQ++AD L
Sbjct:   72 GRTIGDIISTKLGILS-PPPYLSLSQNDDAFLSGINYASGGAGILNETGIYFIQRLTFNDQINCFKKTKEVIRAKIGDGAANKHVNDAMYFIGLGSNDYVNNF-LQPFMADGQQYTHDEFVELLTSTLHNQLTTIYKLGARKVIFHGLGPLGCIPSQRVKSKTRM--CLNRVNEWVLEFNSRTKKLLIDLNKRLPGAKFSFADTYPAVLDLINNPTHYGFKIANTSCCNVDTSVGG--LCLPNSK-MCKNRQDFVFWDAFHPSDSANQILADHL 338          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL65_ARATH (GDSL esterase/lipase At4g18970 OS=Arabidopsis thaliana GN=At4g18970 PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 4.164e-29
Identity = 80/271 (29.52%), Postives = 129/271 (47.60%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTS-YLNHAISLTQQLQYYREYQSKLAKVAGSK-QSASIIKDAIYIVGAGSGDFLQNYYVNPLLN--KVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVI 801
            GK   D   + LGF  Y   Y   +A G+++L G N+ASA +G  + T   L   I+   Q+  +    S++  + G + ++A+ +   IY +G GS D+L NY++    +    Y+P+ Y++ L+N ++  ++ MY  GARKF +  +  +GC P            C  RIN+  + FN K+ S   +  +  P  K    + +    D+V +PS+ GF                   C P     C N  +YVFWD+ HP +AAN VI
Sbjct:   71 GKTTVDVITELLGFDDYITPY--SEARGEDILRGVNYASAAAGIREETGRQLGARITFAGQVANHVNTVSQVVNILGDENEAANYLSKCIYSIGLGSNDYLNNYFMPVYYSTGSQYSPDAYANDLINRYTEQLRIMYNNGARKFALVGIGAIGCSPNELAQNSRDGVTCDERINSANRIFNSKLVSLVDHFNQNTPGAKFTYINAYGIFQDMVANPSRYGF-RVTNAGCCGVGRNNGQITCLP-GQAPCLNRDEYVFWDAFHPGEAANVVI 337          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL67_ARATH (GDSL esterase/lipase At4g28780 OS=Arabidopsis thaliana GN=At4g28780 PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 7.103e-29
Identity = 77/271 (28.41%), Postives = 137/271 (50.55%), Query Frame = 1
Query:   16 DFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGY--DDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPE--QYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            D  ++ +G +   P  LSP+ TG+ LLIGANFASAG G   D    +LN  + + +Q + ++EYQ +++++ GS ++  ++  A+ ++  G  DF+ NY+  P+  +       ++S +L++ +   + ++Y LGAR+  VT   PLGC+PA     G     C       A  FN  +      L +++     +  + F    D + +P + GFV +K              +C P S   CS+ + Y FWD  HP++ A ++I  +++
Sbjct:   80 DIISEQIGSEPTLPI-LSPELTGEKLLIGANFASAGIGILNDTGVQFLN-ILRIGRQFELFQEYQERVSEIIGSDKTQQLVNGALVLMTLGGNDFVNNYFF-PISTRRRQSSLGEFSQLLISEYKKILTSLYELGARRVMVTGTGPLGCVPAELASSGSVNGECAPEAQQAAAIFNPLLVQMLQGLNREIGSDVFIGANAFNTNADFINNPQRFGFVTSK-VACCGQGAYNGQGVCTPLST-LCSDRNAYAFWDPFHPTEKATRLIVQQIM 345          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL79_ARATH (GDSL esterase/lipase At5g33370 OS=Arabidopsis thaliana GN=At5g33370 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 9.277e-29
Identity = 78/271 (28.78%), Postives = 135/271 (49.82%), Query Frame = 1
Query:   16 DFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGY--DDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPL--LNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            D  ++ LG ++  P YLSP      LL GANFASAG G   D    +LN  I +T+QL+Y+ +Y+ +++ + G ++   ++  A+ ++  G  DF+ NYY+ P    ++ ++   Y   +++ +   ++ MY LGAR+  VT   P+GC+PA           C + +   A  FN ++    T+L  ++     +  +  +   D +  P   GFV +K              LC P S   C N   + FWD  HPS+ A+++IA +++
Sbjct:   79 DLISEHLGQESPMP-YLSPMLKKDKLLRGANFASAGIGILNDTGIQFLN-IIRITKQLEYFEQYKVRVSGLVGEEEMNRLVNGALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVVFVISEYRKVLRKMYDLGARRVLVTGTGPMGCVPAELAQRS-RNGECATELQRAASLFNPQLIQMITDLNNEVGSSAFIAANTQQMHMDFISDPQAYGFVTSK-VACCGQGPYNGIGLCTPLS-NLCPNRDLFAFWDPFHPSEKASRIIAQQIL 344          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL77_ARATH (GDSL esterase/lipase At5g18430 OS=Arabidopsis thaliana GN=At5g18430 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.582e-28
Identity = 74/270 (27.41%), Postives = 134/270 (49.63%), Query Frame = 1
Query:   16 DFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSY-LNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNP--LLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            D  ++ +G +     YLSP+  G++LL GANFASAG G  + T +   + I + QQL Y+++YQ +++++ G  Q+  ++  A+ ++  G  DF+ NY++ P    ++ +T   Y  +L++ +   +  +  LG  +  VT   PLGC PA     G     C + +   A  ++ ++      L K++     +  +  +   D + +P + GFV +K              LC   S   C N   YVFWD+ HP++ AN++I   ++
Sbjct:   77 DLISEAIGNEEPPLPYLSPELRGRSLLNGANFASAGIGILNDTGFQFINIIRMYQQLDYFQQYQQRVSRLIGKPQTQRLVSQALVLITVGGNDFVNNYFLFPYSARSRQFTLPDYVRLLISEYKKILLRLNSLGVGRVLVTGAGPLGCAPAELARSGTSNGRCSAELQRAASLYDPQLLQMINELNKKIGRNVFIAANTNQMQEDFLSTPRRYGFVTSK-VACCGQGPYNGMGLCTVLS-NLCPNRELYVFWDAFHPTEKANRMIVRHIL 344          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL35_ARATH (GDSL esterase/lipase At2g19010 OS=Arabidopsis thaliana GN=At2g19010 PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 2.699e-28
Identity = 80/273 (29.30%), Postives = 131/273 (47.99%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTS-YLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLN--KVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESG--CVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIA 804
            G+   D   +  GFK + P +   +A+ +    G N+AS GSG  + TS +L   IS+ +QLQ ++        +  +   A  ++  +Y++  GS D++ NY+++   N  + YTP+QY+  L+ I+ S +KN++ LGARK  V  L  +GC P    +   H  G  C   +N   + FNK +     +  K++   K    D+F         P    F+  K              LC P  P  C+N ++YVFWD +H ++A N V+A
Sbjct:   69 GRTIPDIIGELSGFKDFIPPFA--EASPEQAHTGMNYASGGSGLREETSEHLGDRISIRKQLQNHK------TSITKANVPAERLQQCLYMINIGSNDYINNYFMSKPYNTKRRYTPKQYAYSLIIIYRSHLKNLHRLGARKVAVFGLSQIGCTP---KIMKSHSDGKICSREVNEAVKIFNKNLDDLVMDFNKKVRGAKFTYVDLFSG-----GDPQAFIFLGFKVGGKSCCTVNPGEELCVPNQP-VCANRTEYVFWDDLHSTEATNMVVA 324          
The following BLAST results are available for this feature:
BLAST of DC899996 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 96
Match NameE-valueIdentityDescription
GDL55_ARATH6.864e-3234.10GDSL esterase/lipase At3g43550 OS=Arabidopsis thal... [more]
LTL1_ARATH8.965e-3229.41GDSL esterase/lipase LTL1 OS=Arabidopsis thaliana ... [more]
EXL4_ARATH8.391e-3030.18GDSL esterase/lipase EXL4 OS=Arabidopsis thaliana ... [more]
GLIP7_ARATH1.431e-2930.60GDSL esterase/lipase 7 OS=Arabidopsis thaliana GN=... [more]
GDL80_ARATH2.441e-2929.20GDSL esterase/lipase At5g37690 OS=Arabidopsis thal... [more]
GDL65_ARATH4.164e-2929.52GDSL esterase/lipase At4g18970 OS=Arabidopsis thal... [more]
GDL67_ARATH7.103e-2928.41GDSL esterase/lipase At4g28780 OS=Arabidopsis thal... [more]
GDL79_ARATH9.277e-2928.78GDSL esterase/lipase At5g33370 OS=Arabidopsis thal... [more]
GDL77_ARATH1.582e-2827.41GDSL esterase/lipase At5g18430 OS=Arabidopsis thal... [more]
GDL35_ARATH2.699e-2829.30GDSL esterase/lipase At2g19010 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899996 VSS Citrus sinensis cDNA clone VS27Q07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899996 ID=DC899996|Name=DC899996|organism=Citrus sinensis|type=EST|length=996bp
GGGAAATTAGCCACTGACTTCACTGCTGATACCCTAGGCTTTAAGACTTA
TGCGCCAGCATATCTCAGTCCACAGGCTACAGGGAAAAACCTCCTTATTG
GAGCCAACTTTGCTTCAGCGGGATCTGGTTATGATGACAGGACATCCTAC
TTAAATCATGCAATTTCATTGACTCAGCAGTTGCAGTACTATAGAGAGTA
CCAGAGTAAGCTAGCAAAGGTAGCTGGTAGCAAACAATCAGCTTCCATAA
TCAAGGATGCGATATACATAGTGGGTGCTGGGAGTGGTGACTTTCTTCAG
AATTACTATGTCAATCCTTTACTTAACAAAGTCTACACTCCTGAGCAGTA
TAGCTCAATGCTTGTCAATATTTTCTCAAGTTTTATTAAGAACATGTATG
GATTGGGAGCAAGAAAATTTGGAGTGACTTCACTGCCACCATTGGGTTGC
CTTCCAGCAGCAAGAACTTTATTTGGATATCACGAGAGTGGCTGTGTCTC
TAGAATCAATACTGATGCTCAACAATTTAACAAGAAGGTCAGCTCCGCAG
CAACAAATCTTCAAAAGCAACTTCCTGATCTGAAAATTGTGATTTTCGAC
ATTTTCAAGCCAATCTATGACCTTGTCCAATCCCCTTCAAAATCTGGCTT
CGTGGAGGCAAAAAGAGGTTGCTGTGGAACAGGAACTGTAGAAACAACTG
TCTTTCTGTGCAATCCAAAGTCGCCTGGAACATGCTCCAATGCCTCTCAG
TATGTGTTCTGGGACAGTGTTCATCCTTCTCAGGCTGCTAATCAGGTTAT
TGCCGATGAATTGATTGTTCAAGGATTTGCCCTTCTCTGAAGGGGATGTC
AAATCCATGGAAATGATCAATATTTCTGTTGAGGCTTCTTAATCTTCTTG
GTGTCTGTGCTTCAGTTTATCTGCTTGTCTATACATCATTTTAAGATTTC
CTTTGTTTCTTCTAACATTTGCTATATATACATAGTGTTTTGCTAC
back to top