DC899996

Overview
NameDC899996
Unique NameDC899996
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length996
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1834 contig Csv1_Contig1834:292..1287. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL6_ARATH (GDSL esterase/lipase At1g28570 OS=Arabidopsis thaliana GN=At1g28570 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.137e-18
Identity = 71/293 (24.23%), Postives = 133/293 (45.39%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQAT---GKNLLIGANFASAGSGYDDRTSYLNHA-ISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGA-GSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHE-------SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKS---PGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFAL 834
            G+L  DF A+ LGF    P Y S  A    G N  +G   A   S  ++R  +  +  +SL  QL  ++E    L           +I++++ ++G  G  D+   ++V   + ++   ++   +++   SS I  + G+G + F V    PLGC  A  +L+           +GC+  +N  ++  ++++ +    LQK  P + I+  D +  +  L Q P+K GF+                 L   +    P  C + S+YV WD VH ++AA +++A+ ++   +A+
Sbjct:   80 GRLIIDFIAEFLGFPLVPPFYGSQNANFEKGVNFAVGGATALERSFLEERGIHFPYTNVSLAVQLSSFKESLPNLC--VSPSDCRDMIENSLILMGEIGGNDYNYAFFVGKNIEEI---KELVPLVIETISSAITELIGMGGKTFLVPGEFPLGCSVAYLSLYQTSNIEEYDPLTGCLKWLNKFSEYHDEQLQAELNRLQKLYPHVNIIYADYYNTLLRLAQEPAKFGFISRPLPACCALGGPFNFTLGRKRGTQVPECCDDPSKYVSWDGVHMTEAAYRLMAEGILKGPYAI 367          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: FUCO3_ARATH (Alpha-L-fucosidase 3 OS=Arabidopsis thaliana GN=FXG1 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.532e-18
Identity = 85/300 (28.33%), Postives = 126/300 (42.00%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHA----ISLTQQ-LQYYREY-QSKLAKVAGSKQSASI-----IKDAIYIVGAGSGDFLQNYYVNPLLNKVYT--PEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLF-----GYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEA--KRXXXXXXXXXXXXFLCNPKS---------PGTCSNASQYVFWDSVHPSQAANQVIADEL 813
            G+L  DF A++LG   Y  A+L   + G N   GANFA+AGS      S L  +     SL  Q +Q+Y  + +S+  +  G      +        A+Y    G  D    Y+ N  + +V T  PE     +++ F + IKN+YG G R F + +  P+GCL      F      +   GCVS +N  AQQFN  +  A   L+  L +  I   D++   ++L       GF  +                  C  K             C    + V WD VH +QAAN+ I D++
Sbjct:   70 GRLVIDFIAESLGLP-YLSAFLD--SVGSNFSHGANFATAGSPIRALNSTLRQSGFSPFSLDVQFVQFYNFHNRSQTVRSRGGVYKTMLPESDSFSKALYTFDIGQNDLTAGYFANKTVEQVETEVPE-----IISQFMNAIKNIYGQGGRYFWIHNTGPIGCLAYVIERFPNKASDFDSHGCVSPLNHLAQQFNHALKQAVIELRSSLSEAAITYVDVYSLKHELFVHAQGHGFKGSLVSCCGHGGKYNYNKGIGCGMKKIVKGKEVYIGKPCDEPDKAVVWDGVHFTQAANKFIFDKI 361          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: LIP4_ARATH (GDSL esterase/lipase LIP-4 OS=Arabidopsis thaliana GN=LIP4 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 3.307e-18
Identity = 71/285 (24.91%), Postives = 123/285 (43.16%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASII-------KDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLF---GYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGF---VEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G+L  DF   +L      P   S   T      GANFA AGS     T   N   SL  Q++ +  ++S+  ++A S  S   +       K+A+Y++  G  D  +++      N      +    ++    S IK +Y  G R+F + +  PLGCLP   ++       + GC+   N+ A  FN+ +      L+ +L D  I+  DI+   Y L+ + ++ GF   + A                C  K    C   S+++ WD +H ++ AN ++A +++
Sbjct:   81 GRLLIDFLCQSLNTSLLRPYLDSLGRT--RFQNGANFAIAGSP----TLPKNVPFSLNIQVKQFSHFKSRSLELASSSNSLKGMFISNNGFKNALYMIDIGQNDIARSFARG---NSYSQTVKLIPQIITEIKSSIKRLYDEGGRRFWIHNTGPLGCLPQKLSMVKSKDLDQHGCLVSYNSAATLFNQGLDHMCEELRTELRDATIIYIDIYAIKYSLIANSNQYGFKSPLMACCGYGGTPYNYNVKITCGHKGSNVCEEGSRFISWDGIHYTETANAIVAMKVL 356          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: EST_HEVBR (Esterase OS=Hevea brasiliensis PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 3.307e-18
Identity = 85/302 (28.15%), Postives = 129/302 (42.72%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLN-----HAISLTQQLQYYREY--QSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSM---LVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHE---SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSP------------GTCSNASQYVFWDSVHPSQAANQVIADELIVQGFA 831
            G+L  DF A++      +P YLS  + G N   GA+FA+AGS     T+ +          L  Q   +R++  +S+  +  G   +  + ++  +     + D  QN      LN   T E+ ++    LVN FS+ +K +Y LGAR F + +  P+GCL    T F + E   +GC    N  AQ FN K+      L+K LP    V  DI+   Y L   P K GF E                +  P               G+C+  S  V WD  H ++AAN+   D++    F+
Sbjct:   74 GRLIIDFIAESFNLPYLSP-YLS--SLGSNFKHGADFATAGSTIKLPTTIIPAHGGFSPFYLDVQYSQFRQFIPRSQFIRETGGIFAELVPEEYYFEKALYTFDIGQNDLTEGFLN--LTVEEVNATVPDLVNSFSANVKKIYDLGARTFWIHNTGPIGCLSFILTYFPWAEKDSAGCAKAYNEVAQHFNHKLKEIVAQLRKDLPLATFVHVDIYSVKYSLFSEPEKHGF-EFPLITCCGYGGKYNFSVTAPCGDTVTADDGTKIVVGSCACPSVRVNWDGAHYTEAANEYFFDQISTGAFS 369          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GLIP6_ARATH (GDSL esterase/lipase 6 OS=Arabidopsis thaliana GN=GLIP6 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.257e-17
Identity = 66/275 (24.00%), Postives = 123/275 (44.73%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQAT----GKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADEL 813
            G+   DF ++ +G     P +L  Q        N   G NFASAGSG    T+       +  QLQ ++        V  +    SII+++++++  GS D   NY++ P      +P+ Y + +++  +  I  +Y LGAR+    SL P+GC+PA   L     + C  ++N  A+ +NK++      +  + P    V   ++   +     P++ GF +                 C  +    C+N ++++FWD  HP++   ++++  L
Sbjct:   75 GRTVADFISEFVGLPLQKP-FLELQIQILNGTSNFSNGINFASAGSGLLLDTNKFMGVTPIQTQLQQFQTL------VEQNLIEKSIIQESLFLLETGSNDIF-NYFL-PFRAPTLSPDAYVNAMLDQVNKTIDQIYKLGARRIAFFSLGPVGCVPARAMLPNAPTNKCFGKMNVMAKMYNKRLEDIVNIIPTKYPGAIAVFGAVYGITHRFQTYPARYGFSDVSN-ACCGNGTLGGLMQCGREGYKICNNPNEFLFWDFYHPTEHTYRLMSKAL 339          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL7_ARATH (GDSL esterase/lipase At1g28580 OS=Arabidopsis thaliana GN=At1g28580 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.641e-17
Identity = 72/294 (24.49%), Postives = 132/294 (44.90%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQAT---GKNLLIGANFASAGSGYDDRTSYLNHA-ISLTQQLQYYREYQSKLAKVAGSKQSA-SIIKDAIYIVGA-GSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHE-------SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFL---CNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFAL 834
            G+L  DF A+ LG     P Y S  A    G N  +G   A   S  +DR  +  +  +SL  QL  ++E    L  + GS      +I++A+ ++G  G  D+   ++V+  + ++   ++   +++   SS I  + G+G R F V    P+GC     T             +GC+  +N   +   +++ +    LQK  P + I+  D +  ++ L Q P+K GF+                 +   C      +C + S+YV WD VH ++AA +++A+ ++   +A+
Sbjct:   83 GRLIIDFIAEFLGLPLVPPFYGSHNANFEKGVNFAVGGATALERSFLEDRGIHFPYTNVSLGVQLNSFKE---SLPSICGSPSDCRDMIENALILMGEIGGNDYNYAFFVDKGIEEI---KELMPLVITTISSAITELIGMGGRTFLVPGEFPVGCSVLYLTSHQTSNMEEYDPLTGCLKWLNKFGENHGEQLRAELNRLQKLYPHVNIIYADYYNALFHLYQEPAKFGFMNRPLSACCGAGGPYNYTVGRKCGTDIVESCDDPSKYVAWDGVHMTEAAYRLMAEGILNGPYAI 370          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL87_ARATH (GDSL esterase/lipase At5g55050 OS=Arabidopsis thaliana GN=At5g55050 PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 3.657e-17
Identity = 72/282 (25.53%), Postives = 132/282 (46.81%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKN------LLIGANFASAGSG-YDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFG-YHESGCVSRINTDAQQFNKKVSSAATNLQKQLP-DLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSV-HPSQAANQVIADELI 816
            GK A D  A+  G     P YLS +   K        + G NFAS G+G ++     L  AI L++Q+  +     ++ K+  S     + K +++ V  GS D L +Y+ +  L +   P+QY+ ++ +     +K ++  GAR+F +  +  +GC P  R      HE  C    N     +N+ +      L+++L   +    FD +K ++D++ +P++ GF +                 C P +   CS+ ++++FWD   HP++AA + I D ++
Sbjct:   84 GKNAADAIAEKFGLPL-PPPYLSLRGLLKREKRKSAAVTGVNFASGGAGIFNSSDQKLGQAIPLSKQVNNWLSIHEEVMKLEPSAAQLHLSK-SLFTVVIGSND-LFDYFGSFKLRRQSNPQQYTQLMADKLKEQLKRIHDSGARRFLIIGVAQIGCTPGKRAKNSTLHE--CDEGANMWCSLYNEALVKMLQQLKQELQGSITYTYFDNYKSLHDIISNPARYGFADV-TSACCGNGELNADLPCLPLAK-LCSDRTKHLFWDRYGHPTEAAARTIVDLML 358          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL57_ARATH (GDSL esterase/lipase At3g48460 OS=Arabidopsis thaliana GN=At3g48460 PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 3.657e-17
Identity = 68/282 (24.11%), Postives = 119/282 (42.20%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLI----GANFASAGSGYDDRTSYLNHAISLT---QQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGA-GSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHES---GCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFL--CNPKSPGTCSNASQYVFWDSVHPSQAANQVIAD 807
            G+L  DF A+++    + P YLS + T  N       G NFA +GS       ++ + +SL    Q ++    +  K  +  G+ Q  S+ KD+++ +G  G  D+         L    + +    + ++ F+ F++ +   G +   V   P  GCL  A +L    +    GCV   N  +   N  + S    L+ + P   IV  D +     +++ PSK G  E  +                C   +   C + +QY+ WD VH ++A  +V+AD
Sbjct:   84 GRLTIDFVAESMNLP-FLPPYLSLKTTNANGTATDTHGVNFAVSGSTVIKHAFFVKNNLSLDMTPQSIETELAWFEKYLETLGTNQKVSLFKDSLFWIGEIGVNDYAYT------LGSTVSSDTIRELSISTFTRFLETLLNKGVKYMLVQGHPATGCLTLAMSLAAEDDRDSLGCVQSANNQSYTHNLALQSKLKQLRIKYPSATIVYADYWNAYRAVIKHPSKYGITEKFKACCGIGEPYNFQVFQTCGTDAATVCKDPNQYINWDGVHLTEAMYKVMAD 358          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL12_ARATH (GDSL esterase/lipase At1g28660 OS=Arabidopsis thaliana GN=At1g28660 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 4.776e-17
Identity = 76/291 (26.12%), Postives = 123/291 (42.27%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAI-------SLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGA-GSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHE-------SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFL----CNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G+L  DF A+ LG   Y P Y   Q        G NFA  G+   DR  ++   I       SL  QL  +++    L   + S+    ++ D++ ++G  G  DF         +N+     +   +++   SS I ++  LG + F V    P GC  A  T +           +GC+ R+N   +  N+++ +    LQK  PD+ I+  D    +Y   Q P+K GF + K             F     C  +    C N S+YV WD  H ++AA Q +A+ ++
Sbjct:   81 GRLIIDFIAEFLGLP-YVPPYFGSQNVSFEQ--GINFAVYGATALDRAYFVAKGIESDFTNVSLGVQLDIFKQILPNLC-ASSSRDCREMLGDSLILMGEIGGNDFFYPSSEGKSINET----KLQDLIIKAISSAIVDLIALGGKTFLVPGGFPAGCSAACLTQYQNATEEDYDPLTGCIPRLNELGEHDNEQLKTELKRLQKLYPDVNIIYADYHNSLYRFYQEPAKYGF-KNKPLAACCGVGGKYNFTIGKECGYEGVSYCQNPSEYVNWDGYHLTEAAYQKMAEGIL 362          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL60_ARATH (GDSL esterase/lipase At3g62280 OS=Arabidopsis thaliana GN=At3g62280 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 8.146e-17
Identity = 77/291 (26.46%), Postives = 128/291 (43.99%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASI----IKDAIYIVGAGSGDFLQNYYVNPLLNKVYTP--EQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHES-----GCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVE---AKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFA 831
            G+L  DF  + L   TY   YL   +   N   G NFA +G+     T+    +  L  Q++ +  ++++  ++  S +   I     ++A+Y++  G  D L   Y +   N  Y P  E+  SML+ I  + I+ +Y  G RKF V +  PLGC P    +  +++S     GC    N  A+ FNK + S    L+ Q  D  +V  DI+   Y L       GFV+   A                C       C + ++ + WD VH ++AAN+ + D ++   ++
Sbjct:   77 GRLIVDFYCEHLKM-TYLSPYLD--SLSPNFKRGVNFAVSGA-----TALPIFSFPLAIQIRQFVHFKNRSQELISSGRRDLIDDNGFRNALYMIDIGQNDLLLALYDS---NLTYAPVVEKIPSMLLEIKKA-IQTVYLYGGRKFWVHNTGPLGCAPKELAIHLHNDSDLDPIGCFRVHNEVAKAFNKGLLSLCNELRSQFKDATLVYVDIYSIKYKLSADFKLYGFVDPLMACCGYGGRPNNYDRKATCGQPGSTICRDVTKAIVWDGVHYTEAANRFVVDAVLTNRYS 355          
The following BLAST results are available for this feature:
BLAST of DC899996 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 96
Match NameE-valueIdentityDescription
GDL6_ARATH1.137e-1824.23GDSL esterase/lipase At1g28570 OS=Arabidopsis thal... [more]
FUCO3_ARATH2.532e-1828.33Alpha-L-fucosidase 3 OS=Arabidopsis thaliana GN=FX... [more]
LIP4_ARATH3.307e-1824.91GDSL esterase/lipase LIP-4 OS=Arabidopsis thaliana... [more]
EST_HEVBR3.307e-1828.15Esterase OS=Hevea brasiliensis PE=1 SV=1[more]
GLIP6_ARATH1.257e-1724.00GDSL esterase/lipase 6 OS=Arabidopsis thaliana GN=... [more]
GDL7_ARATH1.641e-1724.49GDSL esterase/lipase At1g28580 OS=Arabidopsis thal... [more]
GDL87_ARATH3.657e-1725.53GDSL esterase/lipase At5g55050 OS=Arabidopsis thal... [more]
GDL57_ARATH3.657e-1724.11GDSL esterase/lipase At3g48460 OS=Arabidopsis thal... [more]
GDL12_ARATH4.776e-1726.12GDSL esterase/lipase At1g28660 OS=Arabidopsis thal... [more]
GDL60_ARATH8.146e-1726.46GDSL esterase/lipase At3g62280 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899996 VSS Citrus sinensis cDNA clone VS27Q07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899996 ID=DC899996|Name=DC899996|organism=Citrus sinensis|type=EST|length=996bp
GGGAAATTAGCCACTGACTTCACTGCTGATACCCTAGGCTTTAAGACTTA
TGCGCCAGCATATCTCAGTCCACAGGCTACAGGGAAAAACCTCCTTATTG
GAGCCAACTTTGCTTCAGCGGGATCTGGTTATGATGACAGGACATCCTAC
TTAAATCATGCAATTTCATTGACTCAGCAGTTGCAGTACTATAGAGAGTA
CCAGAGTAAGCTAGCAAAGGTAGCTGGTAGCAAACAATCAGCTTCCATAA
TCAAGGATGCGATATACATAGTGGGTGCTGGGAGTGGTGACTTTCTTCAG
AATTACTATGTCAATCCTTTACTTAACAAAGTCTACACTCCTGAGCAGTA
TAGCTCAATGCTTGTCAATATTTTCTCAAGTTTTATTAAGAACATGTATG
GATTGGGAGCAAGAAAATTTGGAGTGACTTCACTGCCACCATTGGGTTGC
CTTCCAGCAGCAAGAACTTTATTTGGATATCACGAGAGTGGCTGTGTCTC
TAGAATCAATACTGATGCTCAACAATTTAACAAGAAGGTCAGCTCCGCAG
CAACAAATCTTCAAAAGCAACTTCCTGATCTGAAAATTGTGATTTTCGAC
ATTTTCAAGCCAATCTATGACCTTGTCCAATCCCCTTCAAAATCTGGCTT
CGTGGAGGCAAAAAGAGGTTGCTGTGGAACAGGAACTGTAGAAACAACTG
TCTTTCTGTGCAATCCAAAGTCGCCTGGAACATGCTCCAATGCCTCTCAG
TATGTGTTCTGGGACAGTGTTCATCCTTCTCAGGCTGCTAATCAGGTTAT
TGCCGATGAATTGATTGTTCAAGGATTTGCCCTTCTCTGAAGGGGATGTC
AAATCCATGGAAATGATCAATATTTCTGTTGAGGCTTCTTAATCTTCTTG
GTGTCTGTGCTTCAGTTTATCTGCTTGTCTATACATCATTTTAAGATTTC
CTTTGTTTCTTCTAACATTTGCTATATATACATAGTGTTTTGCTAC
back to top