DC899996

Overview
NameDC899996
Unique NameDC899996
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length996
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1834 contig Csv1_Contig1834:292..1287. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL40_ARATH (GDSL esterase/lipase At2g27360 OS=Arabidopsis thaliana GN=At2g27360 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 8.146e-17
Identity = 75/294 (25.51%), Postives = 132/294 (44.90%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQAT---GKNLLIGANFASAGSGYDDRTSYLNHA-ISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPE--QYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHE-------SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFL---CNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFAL 834
            G+L  DF A+ LG     P Y S       G N  +G   A   S  +++ ++ + + ISL  QL+ ++E    L   + S     +I++A  ++G   G    N Y  PL ++    E  +   +++   SS I  +  +GAR F V    PLGC  A  TL+           +GC++ +N  +   N+++ +    L+   P + I+  D +  +  L+Q PSK G ++                    C  K    CS+ S+YV WD +H ++AA + I++ ++   +A+
Sbjct:   79 GRLIIDFIAEFLGIPHVPPFYGSKNGNFEKGVNFAVGGATALECSVLEEKGTHCSQSNISLGNQLKSFKESLPYLCG-SSSPDCRDMIENAFILIGEIGG----NDYNFPLFDRKNIEEVKELVPLVITTISSAISELVDMGARTFLVPGNFPLGCSVAYLTLYETPNKEEYNPLTGCLTWLNDFSVYHNEQLQAELKRLRNLYPHVNIIYGDYYNTLLRLMQEPSKFGLMDRPLPACCGLGGPYNFTFSIKCGSKGVEYCSDPSKYVNWDGIHMTEAAYKWISEGVLTGPYAI 367          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL16_ARATH (GDSL esterase/lipase At1g31550 OS=Arabidopsis thaliana GN=At1g31550 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.815e-16
Identity = 76/295 (25.76%), Postives = 133/295 (45.08%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAG------SGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGA-GSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHE-------SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFL---CNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFAL 834
            G+L  DF A+ LG   Y P Y    +T  N   G NFA A       S  +++  +  H  SL  QL+ +++    L  +    +   +I +A+ ++G  G+ D+   ++    L++V   ++   ++++  SS I  + G+G R F V    PLGC  A  TL            +GC+  +N   +  ++++      L+K  P + I+  D +     L + PSK GF+                 L   C       CS+ S+YV WD +H ++AA++ +AD L+   +A+
Sbjct:   82 GRLIIDFIAEFLGLP-YVPPYFG--STNGNFEKGVNFAVASATALESSFLEEKGYHCPHNFSLGVQLKIFKQSLPNLCGLPSDCRD--MIGNALILMGEIGANDYNFPFFQLRPLDEV---KELVPLVISTISSAITELIGMGGRTFLVPGGFPLGCSVAFLTLHQTSNMEEYDPLTGCLKWLNKFGEYHSEQLQEELNRLRKLNPHVNIIYADYYNASLRLGREPSKYGFINRHLSACCGVGGPYNFNLSRSCGSVGVEACSDPSKYVAWDGLHMTEAAHKSMADGLVKGPYAI 368          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL13_ARATH (GDSL esterase/lipase At1g28670 OS=Arabidopsis thaliana GN=At1g28670 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 3.095e-16
Identity = 75/291 (25.77%), Postives = 124/291 (42.61%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAI-------SLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGA-GSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHE-------SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFL----CNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G+L  DF A+ LG   Y P Y   Q        G NFA  G+   DR   L   I       SL+ QL  +++    L   + ++    ++ D++ ++G  G  D+   ++    +N++   ++   ++V   SS I ++  LG + F V    P GC  A  TLF           +GC   +N   +  N+++ +    LQK  P + I+  D    +Y   Q P+K GF + K             F     C  +    C N S+YV WD  H ++AA Q + + ++
Sbjct:   81 GRLIIDFIAEFLGLP-YVPPYFGSQNVSFEQ--GINFAVYGATALDRAFLLGKGIESDFTNVSLSVQLDTFKQILPNLC-ASSTRDCKEMLGDSLILMGEIGGNDYNYPFFEGKSINEI---KELVPLIVKAISSAIVDLIDLGGKTFLVPGGFPTGCSAAYLTLFQTVAEKDQDPLTGCYPLLNEFGEHHNEQLKTELKRLQKFYPHVNIIYADYHNSLYRFYQEPAKYGF-KNKPLAACCGVGGKYNFTIGKECGYEGVNYCQNPSEYVNWDGYHLTEAAYQKMTEGIL 363          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL49_ARATH (GDSL esterase/lipase At3g05180 OS=Arabidopsis thaliana GN=At3g05180 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 3.422e-15
Identity = 74/294 (25.17%), Postives = 124/294 (42.18%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQ-------SASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSM---LVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHES-----GCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGF-----VEAKRXXXXXXXXXXXXFLCNPKSPGT------CSNASQYVFWDSVHPSQAANQVIA 804
            G+L  DF  + +  + Y   YL    + +    G NFA+A S      +          Q+  +  ++SK+ ++    +       S     + +Y+   G  D    +Y         T +Q  ++   +++IF   IK +Y  GAR + + +  PLGCL    ++FG  +S     GCVS  N  A+ FN ++      L +Q P+ +    DIF    DL+ + SK GF     V                     +S GT      C ++S+YV WD +H ++AAN+ +A
Sbjct:   78 GRLIVDFLMEAID-RPYLRPYLD-SISRQTYRRGCNFAAAASTIQKANAASYSPFGFGVQVSQFITFKSKVLQLIQQDEELQRYLPSEYFFSNGLYMFDIGQNDIAGAFYTK-------TVDQVLALVPIILDIFQDGIKRLYAEGARNYWIHNTGPLGCLAQVVSIFGEDKSKLDEFGCVSDHNQAAKLFNLQLHGLFKKLPQQYPNSRFTYVDIFSIKSDLILNHSKYGFDHSIMVCCGTGGPPLNYDDQVGCGKTARSNGTIITAKPCYDSSKYVNWDGIHYTEAANRFVA 362          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL61_ARATH (GDSL esterase/lipase At4g01130 OS=Arabidopsis thaliana GN=At4g01130 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 5.838e-15
Identity = 78/296 (26.35%), Postives = 123/296 (41.55%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSG--------YDDRTSYLNHAISLTQQLQYYREY-QSKLAKVAGSK--QSASIIKDAIYIVGAGSGDFLQNYY-VNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHES-----GCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPS----KSGFVEAKRXXXXXXXXXXXXFLCNPKSPG-------TCSNASQYVFWDSVHPSQAANQVIA 804
            G+L  DF A +LG    +P YL  Q+ G +   GANFA+  S         +    S  + AI L Q  Q+     +S      G K   S  +   ++Y    G  DF  N   +     K+Y P+     ++   +  IK +YG+G R F V +L P+GC PA  T + + ++     GC+  +N   + +N  ++   +  + +L +  ++  D  K + DL Q P     K G                  F  N K  G        C +   YV WD +H ++AAN  I+
Sbjct:   74 GRLIIDFLAKSLGMPFLSP-YL--QSIGSDFRHGANFATLASTVLLPNTSLFVSGISPFSLAIQLNQMKQFKVNVDESHSLDRPGLKILPSKIVFGKSLYTFYIGQNDFTSNLASIGVERVKLYLPQ-----VIGQIAGTIKEIYGIGGRTFLVLNLAPVGCYPAILTGYTHTDADLDKYGCLIPVNKAVKYYNTLLNKTLSQTRTELKNATVIYLDTHKILLDLFQHPKSYGMKHGIKACCGYGGRPYNFNQKLFCGNTKVIGNFSTTAKACHDPHNYVSWDGIHATEAANHHIS 361          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL9_ARATH (GDSL esterase/lipase At1g28600 OS=Arabidopsis thaliana GN=At1g28600 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 7.624e-15
Identity = 74/291 (25.43%), Postives = 125/291 (42.96%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAG-----SGYDDRTSYLNHA-ISLTQQLQYYREYQSKLAKVAGSKQSA-SIIKDAIYIVGAGSGDFLQNYYVNPLLNK--VYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHE-------SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFL---CNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G++  DF A+ +G   Y P Y   +   +N   G NFA AG     S +  +     H  +SL  QL   + ++  L  + GS      +I +A+ ++G   G    N Y  P  N+  V   E+    ++   SS I  + G+G + F V    P+GC     TL+           +GC+  +N   +  ++K+      L+K  P + I+  D +  +  + + P+K GF+E                    C      +C + S+YV WD VH ++AA + IAD ++
Sbjct:   77 GRIIMDFIAEFVGLP-YVPPYFGSK--NRNFDKGVNFAVAGATALKSSFLKKRGIQPHTNVSLGVQL---KSFKKSLPNLCGSPSDCRDMIGNALILMGEIGG----NDYNFPFFNRKPVKEVEELVPFVIASISSTITELIGMGGKTFLVPGEFPIGCSVVYLTLYKTSNKDEYDPSTGCLKWLNKFGEYHSEKLKVELNRLRKLYPHVNIIYADYYNSLLRIFKEPAKFGFMERPFPACCGIGGPYNFNFTRKCGSVGVKSCKDPSKYVGWDGVHMTEAAYKWIADGIL 357          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL54_ARATH (GDSL esterase/lipase At3g27950 OS=Arabidopsis thaliana GN=At3g27950 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.301e-14
Identity = 71/294 (24.15%), Postives = 122/294 (41.50%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTS-----YLNHAISL-----TQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSF---IKNMYGLGARKFGVTSLPPLGCLPAARTLFGY---HESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVE-----AKRXXXXXXXXXXXXFLCNPK-SPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G+L  DF  + L      P YL   + G N   GANFA+ GS      +     +L   +S      T+ L  Y +   K  +++ +    +    A+Y +  G  D    +       +  T EQ  + +  I  +F   +K +Y  GAR F + +  P GCLP     F        GC+  +N  A +FNK++ +  T L+K+LP       D++   Y+L+      GF++                    FL   +    +C N   ++ WD +H ++ AN ++A+ ++
Sbjct:   72 GRLIIDFITENLTLPYLTP-YLD--SVGANYRHGANFATGGSCIRPTLACFSPFHLGTQVSQFIHFKTRTLSLYNQTNGKFNRLSHT----NYFSKALYTLDIGQNDLAIGF-------QNMTEEQLKATIPLIIENFTIALKLLYKEGARFFSIHNTGPTGCLPYLLKAFPAIPRDPYGCLKPLNNVAIEFNKQLKNKITQLKKELPSSFFTYVDVYSAKYNLITKAKALGFIDPFDYCCVGAIGRGMGCGKTIFLNGTELYSSSCQNRKNFISWDGIHYTETANMLVANRIL 351          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL8_ARATH (GDSL esterase/lipase At1g28590 OS=Arabidopsis thaliana GN=At1g28590 PE=2 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 2.218e-14
Identity = 75/298 (25.17%), Postives = 129/298 (43.29%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHA--------ISLTQQLQYYREYQSKLAKVAGSKQSA-SIIKDAIYIVGA-GSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHE-------SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFL---CNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFAL 834
            G+L  DF A+ LGF    P Y    A  K    G NFA AG+   +  S+L           +SL+ QL   R +   L  + GS      +I++A+ ++G  G  D+    +    + +V   E+    ++   SS I  +  +G R F V    P+G   +  TL+           +GC+  +N  ++ +NK++      L+K  P + I+  D +  +  L Q P+K GF+                     C       C + SQYV +D +H ++AA ++I++ L+   +A+
Sbjct:   82 GRLIIDFIAEFLGFPLVPPFYGCQNANFKK---GVNFAVAGATALE-PSFLEERGIHSTITNVSLSVQL---RSFTESLPNLCGSPSDCRDMIENALILMGEIGGNDYNFALFQRKPVKEV---EELVPFVIATISSAITELVCMGGRTFLVPGNFPIGYSASYLTLYKTSNKEEYDPLTGCLKWLNDFSEYYNKQLQEELNGLRKLYPHVNIIYADYYNALLRLFQEPAKFGFMNRPLPACCGVGGSYNFNFSRRCGSVGVEYCDDPSQYVNYDGIHMTEAAYRLISEGLLKGPYAI 369          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL21_ARATH (GDSL esterase/lipase At1g54030 OS=Arabidopsis thaliana GN=At1g54030 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.784e-14
Identity = 69/267 (25.84%), Postives = 110/267 (41.20%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGS---GYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAAN 792
            G +  D+ A  +G    +P  L    T  +   GANFA A +   G    T      ++L+QQ++ + E ++K      S        +AIY++  GS D+L     NP  +     + +   ++    + IK +YG G RKF   +L PLGCLPA +   G +   CV   +  A   NKK+      L ++L   +   +D F  I + V       F                    N  +   C+   +Y+F+D  H +Q AN
Sbjct:   95 GSIVPDYLAKFMGIPKISPILL----TTADFSHGANFAIADATVLGSPPET------MTLSQQVKKFSENKNKWTNQTRS--------EAIYLIYIGSDDYLSYAKSNPSPSDTQK-QAFVDQVITTIKAEIKVVYGSGGRKFAFQNLAPLGCLPAVKQASG-NVQECVKLPSEMAALHNKKLLQLLVELSRELNGFQYSFYDFFSSIQNRVIKSKTYTFETGNAACCGTGSING----SNCSAKNVCAKPEEYIFFDGKHLTQEAN 337          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL83_ARATH (GDSL esterase/lipase At5g45910 OS=Arabidopsis thaliana GN=At5g45910 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.101e-13
Identity = 78/303 (25.74%), Postives = 125/303 (41.25%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLI--GANFASAGSGYDDRTSYLNHAISLTQ--------QLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGL----GARKFGVTSLPPLGCLPAARTLFGYHE-------SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGF----VEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFAL 834
            G+L  DF A+  G   Y P YL    T  ++    GANFA AG+  ++ + + N  +S+T         QL ++++ +  L K     +     + ++++VG   G    N Y  PLL   +   +++  LV    + I ++       GA    V    P+GC  A    F  +        + C   +N  A+  N K+      L+K+ P  KI+  D +        SPSK GF    ++A                C  K   TC + S Y  WD +H ++AA + IA  LI   F +
Sbjct:   75 GRLIIDFIAEASGLP-YIPPYLQSLRTNDSVDFKRGANFAVAGATANEFSFFKNRGLSVTLLTNKTLDIQLDWFKKLKPSLCKT--KPECEQYFRKSLFLVGEIGG----NDYNYPLL--AFRSFKHAMDLVPFVINKIMDVTSALIEEGAMTLIVPGNLPIGCSAALLERFNDNSGWLYDSRNQCYMPLNNLAKLHNDKLKKGLAALRKKYPYAKIIYADYYSSAMQFFNSPSKYGFTGSVLKACCGGGDGRYNVQPNVRCGEKGSTTCEDPSTYANWDGIHLTEAAYRHIATGLISGRFTM 368          
The following BLAST results are available for this feature:
BLAST of DC899996 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 96
Match NameE-valueIdentityDescription
GDL40_ARATH8.146e-1725.51GDSL esterase/lipase At2g27360 OS=Arabidopsis thal... [more]
GDL16_ARATH1.815e-1625.76GDSL esterase/lipase At1g31550 OS=Arabidopsis thal... [more]
GDL13_ARATH3.095e-1625.77GDSL esterase/lipase At1g28670 OS=Arabidopsis thal... [more]
GDL49_ARATH3.422e-1525.17GDSL esterase/lipase At3g05180 OS=Arabidopsis thal... [more]
GDL61_ARATH5.838e-1526.35GDSL esterase/lipase At4g01130 OS=Arabidopsis thal... [more]
GDL9_ARATH7.624e-1525.43GDSL esterase/lipase At1g28600 OS=Arabidopsis thal... [more]
GDL54_ARATH1.301e-1424.15GDSL esterase/lipase At3g27950 OS=Arabidopsis thal... [more]
GDL8_ARATH2.218e-1425.17GDSL esterase/lipase At1g28590 OS=Arabidopsis thal... [more]
GDL21_ARATH3.784e-1425.84GDSL esterase/lipase At1g54030 OS=Arabidopsis thal... [more]
GDL83_ARATH1.101e-1325.74GDSL esterase/lipase At5g45910 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899996 VSS Citrus sinensis cDNA clone VS27Q07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899996 ID=DC899996|Name=DC899996|organism=Citrus sinensis|type=EST|length=996bp
GGGAAATTAGCCACTGACTTCACTGCTGATACCCTAGGCTTTAAGACTTA
TGCGCCAGCATATCTCAGTCCACAGGCTACAGGGAAAAACCTCCTTATTG
GAGCCAACTTTGCTTCAGCGGGATCTGGTTATGATGACAGGACATCCTAC
TTAAATCATGCAATTTCATTGACTCAGCAGTTGCAGTACTATAGAGAGTA
CCAGAGTAAGCTAGCAAAGGTAGCTGGTAGCAAACAATCAGCTTCCATAA
TCAAGGATGCGATATACATAGTGGGTGCTGGGAGTGGTGACTTTCTTCAG
AATTACTATGTCAATCCTTTACTTAACAAAGTCTACACTCCTGAGCAGTA
TAGCTCAATGCTTGTCAATATTTTCTCAAGTTTTATTAAGAACATGTATG
GATTGGGAGCAAGAAAATTTGGAGTGACTTCACTGCCACCATTGGGTTGC
CTTCCAGCAGCAAGAACTTTATTTGGATATCACGAGAGTGGCTGTGTCTC
TAGAATCAATACTGATGCTCAACAATTTAACAAGAAGGTCAGCTCCGCAG
CAACAAATCTTCAAAAGCAACTTCCTGATCTGAAAATTGTGATTTTCGAC
ATTTTCAAGCCAATCTATGACCTTGTCCAATCCCCTTCAAAATCTGGCTT
CGTGGAGGCAAAAAGAGGTTGCTGTGGAACAGGAACTGTAGAAACAACTG
TCTTTCTGTGCAATCCAAAGTCGCCTGGAACATGCTCCAATGCCTCTCAG
TATGTGTTCTGGGACAGTGTTCATCCTTCTCAGGCTGCTAATCAGGTTAT
TGCCGATGAATTGATTGTTCAAGGATTTGCCCTTCTCTGAAGGGGATGTC
AAATCCATGGAAATGATCAATATTTCTGTTGAGGCTTCTTAATCTTCTTG
GTGTCTGTGCTTCAGTTTATCTGCTTGTCTATACATCATTTTAAGATTTC
CTTTGTTTCTTCTAACATTTGCTATATATACATAGTGTTTTGCTAC
back to top