DC899996

Overview
NameDC899996
Unique NameDC899996
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length996
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1834 contig Csv1_Contig1834:292..1287. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL51_ARATH (GDSL esterase/lipase At3g14220 OS=Arabidopsis thaliana GN=At3g14220 PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 4.184e-13
Identity = 66/274 (24.09%), Postives = 114/274 (41.61%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGS---GYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSS--AATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIAD 807
            G +  DF    +G +   P  L P+A   +L  GA+FA AG+   G    T+ +N    +++ L+ ++++  K               +AIY+V  G+ D+L     +P  N V    Q + +L  I           GARKF V +L PLGCLP  R  F   E+ C+  +N   +  N+++S    A  +       +  +FD    I   +  PS  G+ +                  +      CS    ++F+D  H ++  ++ +A+
Sbjct:   75 GHIVPDFVGRLIGHREPIPPVLDPKA---DLSRGASFAIAGAVVLGSQSTTASMNFGQQISKFLELHKQWTDKERA------------EAIYMVNIGAEDYLNFAKAHPNANTVEQLTQVAHVLQRIPRELTSLYRAGGARKFAVQNLGPLGCLPIVRQEFKTGEN-CMEMVNFMVKTHNERLSRLLVAITVPLLYRGFRYSLFDFNGEILRRINEPSLHGYTDTTTSCCGTGSRNAYGCGYSNVHAKLCSYQKSFLFFDGRHNTEKTDEEVAN 332          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL20_ARATH (GDSL esterase/lipase At1g54020 OS=Arabidopsis thaliana GN=At1g54020 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.590e-12
Identity = 67/269 (24.91%), Postives = 111/269 (41.26%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGF-VEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIA 804
            GK+  DF A  +G     P  L P   G ++  GA+FA   +           +++L QQ++ + +  S              I+ +++++  G  D+  N+  N    +V   + + + + N F S I  +Y  GA KF V  L PLGCLP AR  F    + C  ++N  A+Q N K+      + +  PD +  +FD +  I    Q      F V                 L N  S   C     Y+++D+ H ++ A +  A
Sbjct:   76 GKIVPDFIAKFMGIPHDLPPALKP---GTDVSRGASFAVGSASI---LGSPKDSLALNQQVRKFNQMISNW--------KVDYIQKSVFMISIGMEDYY-NFTKNNPNAEVSAQQAFVTSVTNRFKSDINLLYSSGASKFVVHLLAPLGCLPIARQEF-KTGNNCYEKLNDLAKQHNAKIGPILNEMAETKPDFQFTVFDFYNVILRRTQRNMNYRFSVTNISCCGVGTHYAYGCGLPNVHSK-LCEYQRSYLYFDARHNTEKAQEAFA 327          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL53_ARATH (GDSL esterase/lipase At3g26430 OS=Arabidopsis thaliana GN=At3g26430 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 3.542e-12
Identity = 76/300 (25.33%), Postives = 120/300 (40.00%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHA----ISLTQQLQYYREY--QSKLAKVAGSKQSASIIK-----DAIYIVGAGSGDFLQNYYVNPLLN--KVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHES-----GCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFL--CNPK---------SPGTCSNASQYVFWDSVHPSQAANQVIADEL 813
            G+L  DF A+ LG   Y  A+L   + G N   GANFA+AGS      + +  +    ISL  QL  + ++  +S+L +  G      + K      A+Y    G  D      +N   +  K Y P+ +  +     S+ I+ +Y  G R+F + +  PLGCLP     F    S     GC    N  A+ +N ++      L+K+L +      DI+     L+    K GF                  L  C  K            +C++ S  V WD +H ++  N  I  ++
Sbjct:   71 GRLIIDFIAEELGLP-YLNAFLD--SIGSNFSHGANFATAGSTVRPPNATIAQSGVSPISLDVQLVQFSDFITRSQLIRNRGGVFKKLLPKKEYFSQALYTFDIGQNDLTAGLKLNMTSDQIKAYIPDVHDQL-----SNVIRKVYSKGGRRFWIHNTAPLGCLPYVLDRFPVPASQIDNHGCAIPRNEIARYYNSELKRRVIELRKELSEAAFTYVDIYSIKLTLITQAKKLGFRYPLVACCGHGGKYNFNKLIKCGAKVMIKGKEIVLAKSCNDVSFRVSWDGIHFTETTNSWIFQQI 362          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL32_ARATH (GDSL esterase/lipase At2g03980 OS=Arabidopsis thaliana GN=At2g03980 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 3.542e-12
Identity = 66/277 (23.83%), Postives = 119/277 (42.96%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLL-IGANFASAGSGYDDRTS-YLNHAISLTQQLQYYRE-YQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLP--AARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSK----SGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIA 804
            GK   D+ A   G     PAYL      KN +  G N+ASAG G   +T   +   +SL+ Q+  ++E   + L K     +    + ++++++  G  D+        L N+     ++++ L++ +   I+ ++ LGARKF + ++ PLGC P   A+T+       C   +N     FN K+  + + + ++      +  D +  +  L + PS     S  +                  C P S   C     ++F+D  HP+Q AN + A
Sbjct:   87 GKTIADYIAIYYGLPL-VPAYLGLSQEEKNSISTGINYASAGCGILPQTGRQIGTCLSLSVQVDMFQETITNNLKKNFKKSELREHLAESLFMIAIGVNDYTF------LFNETTDANEFANKLLHDYLLQIERLHKLGARKFFINNIKPLGCYPNVVAKTV---PRGSCNDALNFAVSIFNTKLRKSLSRMTQKFIKTSFLYSDYYNYMLGL-RGPSSNQVGSSLLNVTSPCCPNVYDGGQLTSCKPGSI-ACKAPDTHIFFDPFHPTQLANYMYA 351          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL1_CARPA (GDSL esterase/lipase OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 6.041e-12
Identity = 71/276 (25.72%), Postives = 114/276 (41.30%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGS---GYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKV-YTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESG--CVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKS--PGTCSNASQYVFWDSVHPSQAANQVIA 804
            G++  DF A+ LG   + P  L   A   N   G  FA+A +   G   +T      ++L  Q++ + + +S        K         IY+   G+ D+L   Y N  LN      E + S ++      +  +YGLG RKF   +L PLGCLP  +  F   ++G  C+   +  A Q N+ +S    NL + L     +I+D F      +  P+  G+                 F C  K+     CS    Y+F+D  H ++  N+ +A
Sbjct:   70 GRIVPDFIAEFLGIP-FPPPVLDRSA---NFSSGVTFATADATILGTPPQT------LTLGDQVKAFAQIKSTWTDAQRQK--------GIYMFYIGANDYLN--YTNANLNATAQQQEAFVSQVIAKLKDQLLAIYGLGGRKFAFQNLAPLGCLPIVKQDF---KTGNFCLPLASNLAAQHNQLLSETLENLSETLDGFNYIIYDYFNSSLRRMARPNNYGYFTTN--LACCGTGSHDAFGCGFKNVHSNLCSYQRGYMFFDGRHNAEKTNEAVA 320          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL19_ARATH (GDSL esterase/lipase At1g54010 OS=Arabidopsis thaliana GN=At1g54010 PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.346e-11
Identity = 65/269 (24.16%), Postives = 103/269 (38.29%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLP---DLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQV 798
            G +A DF A  +      P  L P     N+  GA+FA A     D T       SLT   Q  +  Q K A       +   +K +++++  G+ D+L     NP  +   T + + + + N   + I  +Y  GA KF + +L PLGCLP  R  F      C  ++N  A+Q N+K+      L +  P     +  +FD +  I    Q      F                           C     Y+F+D  H ++ A ++
Sbjct:   79 GLIAPDFLAKFMRIPIVIPPALQPNV---NVSRGASFAVA-----DATLLGAPVESLTLNQQVRKFNQMKAAN-----WNDDFVKKSVFMIYIGANDYLNFTKNNPNAD-ASTQQAFVTSVTNKLKNDISLLYSSGASKFVIQTLAPLGCLPIVRQEFNTGMDQCYEKLNDLAKQHNEKIGPMLNELARTAPASAPFQFTVFDFYNAILTRTQRNQNFRFFVTNASCCGVGTHDAYGCGFPNVHSRLCEYQRSYLFFDGRHNTEKAQEM 333          
The following BLAST results are available for this feature:
BLAST of DC899996 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 96
Match NameE-valueIdentityDescription
GDL51_ARATH4.184e-1324.09GDSL esterase/lipase At3g14220 OS=Arabidopsis thal... [more]
GDL20_ARATH1.590e-1224.91GDSL esterase/lipase At1g54020 OS=Arabidopsis thal... [more]
GDL53_ARATH3.542e-1225.33GDSL esterase/lipase At3g26430 OS=Arabidopsis thal... [more]
GDL32_ARATH3.542e-1223.83GDSL esterase/lipase At2g03980 OS=Arabidopsis thal... [more]
GDL1_CARPA6.041e-1225.72GDSL esterase/lipase OS=Carica papaya PE=1 SV=1[more]
GDL19_ARATH1.346e-1124.16GDSL esterase/lipase At1g54010 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899996 VSS Citrus sinensis cDNA clone VS27Q07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899996 ID=DC899996|Name=DC899996|organism=Citrus sinensis|type=EST|length=996bp
GGGAAATTAGCCACTGACTTCACTGCTGATACCCTAGGCTTTAAGACTTA
TGCGCCAGCATATCTCAGTCCACAGGCTACAGGGAAAAACCTCCTTATTG
GAGCCAACTTTGCTTCAGCGGGATCTGGTTATGATGACAGGACATCCTAC
TTAAATCATGCAATTTCATTGACTCAGCAGTTGCAGTACTATAGAGAGTA
CCAGAGTAAGCTAGCAAAGGTAGCTGGTAGCAAACAATCAGCTTCCATAA
TCAAGGATGCGATATACATAGTGGGTGCTGGGAGTGGTGACTTTCTTCAG
AATTACTATGTCAATCCTTTACTTAACAAAGTCTACACTCCTGAGCAGTA
TAGCTCAATGCTTGTCAATATTTTCTCAAGTTTTATTAAGAACATGTATG
GATTGGGAGCAAGAAAATTTGGAGTGACTTCACTGCCACCATTGGGTTGC
CTTCCAGCAGCAAGAACTTTATTTGGATATCACGAGAGTGGCTGTGTCTC
TAGAATCAATACTGATGCTCAACAATTTAACAAGAAGGTCAGCTCCGCAG
CAACAAATCTTCAAAAGCAACTTCCTGATCTGAAAATTGTGATTTTCGAC
ATTTTCAAGCCAATCTATGACCTTGTCCAATCCCCTTCAAAATCTGGCTT
CGTGGAGGCAAAAAGAGGTTGCTGTGGAACAGGAACTGTAGAAACAACTG
TCTTTCTGTGCAATCCAAAGTCGCCTGGAACATGCTCCAATGCCTCTCAG
TATGTGTTCTGGGACAGTGTTCATCCTTCTCAGGCTGCTAATCAGGTTAT
TGCCGATGAATTGATTGTTCAAGGATTTGCCCTTCTCTGAAGGGGATGTC
AAATCCATGGAAATGATCAATATTTCTGTTGAGGCTTCTTAATCTTCTTG
GTGTCTGTGCTTCAGTTTATCTGCTTGTCTATACATCATTTTAAGATTTC
CTTTGTTTCTTCTAACATTTGCTATATATACATAGTGTTTTGCTAC
back to top