DC899994

Overview
NameDC899994
Unique NameDC899994
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length854
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1834 contig Csv1_Contig1834:431..1284. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL89_ARATH (GDSL esterase/lipase At5g63170 OS=Arabidopsis thaliana GN=At5g63170 PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 3.985e-35
Identity = 78/228 (34.21%), Postives = 122/228 (53.51%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSA-SIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQ 683
            T+ +   I +  QL  ++ Y +KL  + G ++   SII +A++++ +G+ D    Y+ NP+ N  YT   Y+ ++V+   SFIK +Y LGARKF +    PLGCLP A    G     C+   N  A+ FN+K++    NL   LP  + +  D++ P+ +LV++P +SGF+                  C P +P  C +AS+YVFWD  HPS+ A Q I   +I Q
Sbjct:  119 TARIQGVIWVPDQLNDFKAYIAKLNSITGDEEKTRSIISNAVFVISAGNNDIAITYFTNPIRNTRYTIFSYTDLMVSWTQSFIKELYNLGARKFAIMGTLPLGCLPGASNALG---GLCLEPANAVARLFNRKLADEVNNLNSMLPGSRSIYVDMYNPLLELVKNPLRSGFISPTRPC-----------CCAPAAPIPCLDASRYVFWDIAHPSEKAYQTIIPPIIQQ 332          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL26_ARATH (GDSL esterase/lipase At1g59030/At1g59406 OS=Arabidopsis thaliana GN=At1g59030 PE=2 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 3.374e-34
Identity = 80/226 (35.40%), Postives = 126/226 (55.75%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFG-YHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            T+ +   IS+  QL  ++EY SK+ +  G +++  I++ + ++V S S D    Y         Y    Y++ L +    F++ ++ LGARK GV S  P+GC+P  RT+FG +   GC   +N  A+QFN ++S A  +L K+L D  I+  +++  ++D++Q P K GF E               +LCN  +P TCSN+S Y+FWDS HPS+ A QVI D L+
Sbjct:  121 TAKIMSVISVWDQLINFKEYISKIKRHFGEEKAKDILEHSFFLVVSSSNDLAHTYLAQ---THRYDRTSYANFLADSAVHFVRELHKLGARKIGVFSAVPVGCVPLQRTVFGGFFTRGCNQPLNNMAKQFNARLSPALDSLDKEL-DGVILYINVYDTLFDMIQHPKKYGF-EVADRGCCGKGLLAISYLCNSLNPFTCSNSSAYIFWDSYHPSERAYQVIVDNLL 341          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL25_ARATH (GDSL esterase/lipase At1g58725 OS=Arabidopsis thaliana GN=At1g58725 PE=2 SV=2)

HSP 1 Score: 145.591 bits (366), Expect = 3.374e-34
Identity = 80/226 (35.40%), Postives = 126/226 (55.75%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFG-YHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            T+ +   IS+  QL  ++EY SK+ +  G +++  I++ + ++V S S D    Y         Y    Y++ L +    F++ ++ LGARK GV S  P+GC+P  RT+FG +   GC   +N  A+QFN ++S A  +L K+L D  I+  +++  ++D++Q P K GF E               +LCN  +P TCSN+S Y+FWDS HPS+ A QVI D L+
Sbjct:  121 TAKIMSVISVWDQLINFKEYISKIKRHFGEEKAKDILEHSFFLVVSSSNDLAHTYLAQ---THRYDRTSYANFLADSAVHFVRELHKLGARKIGVFSAVPVGCVPLQRTVFGGFFTRGCNQPLNNMAKQFNARLSPALDSLDKEL-DGVILYINVYDTLFDMIQHPKKYGF-EVADRGCCGKGLLAISYLCNSLNPFTCSNSSAYIFWDSYHPSERAYQVIVDNLL 341          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: EXL1_ARATH (GDSL esterase/lipase EXL1 OS=Arabidopsis thaliana GN=EXL1 PE=2 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 3.374e-34
Identity = 76/218 (34.86%), Postives = 121/218 (55.50%), Query Frame = 3
Query:   24 ISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            I L QQL Y+ EY  KL ++ G K++  IIK+++++V  GS D   +++  P +   YT   +++++ +   SF + +YG GAR+  V   PP+GC+P+ RT+ G     CV+R N  A+ FN K+S+    L + L D  I+  DI+ P+ DL+ +P + GF  A               LCN  +   C   S YVFWDS HP++ A ++I  +L+
Sbjct:  151 IPLPQQLIYFEEYIEKLKQMVGEKRTKFIIKNSLFVVICGSNDIANDFFTLPPVRLHYTVASFTALMADNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRDCVARFNDAAKLFNTKLSANIDVLSRTLQDPTIIYIDIYSPLLDLILNPHQYGFKVANKGCCGTGLIEVTA-LCNNYTASVCPIRSDYVFWDSFHPTEKAYRIIVAKLL 367          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL24_ARATH (GDSL esterase/lipase At1g58480 OS=Arabidopsis thaliana GN=At1g58480 PE=3 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.282e-33
Identity = 79/226 (34.96%), Postives = 125/226 (55.31%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFG-YHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            T+ +   IS+  QL Y++EY SK+ +  G +++  I++ + ++V S S D    Y         Y    Y++ L +    F++ ++ LGARK GV S  P+GC+P  RT+FG +   GC   +N  A+QFN ++S A  +L K+L D  I+  +++  ++D++Q P K G                  +LCN  +P TCSN+S Y+FWDS HPS+ A QVI D L+
Sbjct:  121 TAKIMSVISVWDQLIYFKEYISKIKRHFGEEKAKDILEHSFFLVVSSSNDLAHTYLAQA---HRYDRTSYANFLADSAVHFVRELHKLGARKIGVFSAVPVGCVPLQRTVFGGFFTRGCNEPLNNMAKQFNARLSPALDSLDKEL-DGVILYINVYDTLFDMIQHPKKYG--------CCGKGLLTISYLCNSLNPFTCSNSSSYIFWDSYHPSERAYQVIVDNLL 334          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL86_ARATH (GDSL esterase/lipase At5g45960 OS=Arabidopsis thaliana GN=At5g45960 PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 2.856e-33
Identity = 77/219 (35.16%), Postives = 117/219 (53.42%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLF---GYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDL--KIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQ 644
            T  + + I +  QL+Y+REY+ KL    G ++    I++A++ V +G+ DF+ NY+  P+  K +T E Y   +++    FI+ ++  GARK  V  LPP+GCLP   TLF         C+ R +T A  +N  +      +Q  L  L  KI   D++ P+Y++++ P K GF E               FLCNPKS   C N S YVF+DS+HPS+
Sbjct:  138 TPTITNVIDIPTQLEYFREYKRKLEGKMGKQEMEKHIEEAMFCVSAGTNDFVINYFTIPIRRKTFTIEAYQQFVISNLKQFIQGLWKEGARKITVAGLPPIGCLPIVITLFSGEALTNRRCIDRFSTVATNYNFLLQKQLALMQVGLAHLGSKIFYLDVYNPVYEVIRDPRKFGF-EEVFSGCCGSGYLEASFLCNPKS-YVCPNTSAYVFFDSIHPSE 354          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL5_ARATH (GDSL esterase/lipase At1g23500 OS=Arabidopsis thaliana GN=At1g23500 PE=3 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 2.418e-32
Identity = 79/219 (36.07%), Postives = 117/219 (53.42%), Query Frame = 3
Query:   24 ISLTQQLQYYREYQSKLAKVAGSKQSAS-IIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            I +  Q++ ++EY  KL  V   K+  + II +A+Y++ +G+ D    Y   P L   YT   Y+ +LV    + +K++Y +GARKF V    PLGCLP AR   G   + C+  IN  A  FN+K+S+   NL   LP  K V  D++ P+ +L+ +P  SGF++                 C P SP  C +ASQYVFWD  HPS+ +   IA ++I
Sbjct:  133 IWVPDQVKDFKEYIMKLNGVVRDKRKVNAIISNAVYLISAGNNDLAITY---PTLMAQYTVSTYTDLLVTWTDNLLKSLYAMGARKFAVLGTLPLGCLPGARHTGGNFGNICLVPINQVAAIFNQKLSAKLNNLHTILPGAKFVYVDMYNPLLNLINNPRASGFIDVADGC-----------CCMPTSPVPCPDASQYVFWDFAHPSEKSYMTIAPKII 337          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL1_ARATH (GDSL esterase/lipase At1g06990 OS=Arabidopsis thaliana GN=At1g06990 PE=2 SV=2)

HSP 1 Score: 139.428 bits (350), Expect = 2.418e-32
Identity = 75/234 (32.05%), Postives = 126/234 (53.85%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLF--GYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFALL 698
            T      +S+ +Q    R Y  +L+++ G +++ASI+ +A+ IV SG+ DF  N Y  P   +    + Y S +++   +F++ +Y +G RK  V  LPP+GCLP   T+     +E  C+ + N+D+Q+FN+K+ ++ T +Q  L    I   DI+  ++D+  +P + G  E               +LCN  +   C N +QY+FWD +HPSQ A  VI+  L+ Q F +L
Sbjct:  128 TDRATSTLSVDKQADMLRSYVERLSQIVGDEKAASIVSEALVIVSSGTNDFNLNLYDTPSRRQKLGVDGYQSFILSNVHNFVQELYDIGCRKIMVLGLPPVGCLPIQMTMAMQKQNERRCIDKQNSDSQEFNQKLKNSLTEMQSNLTGSVIFYGDIYGALFDMATNPQRYGLKET-TRGCCGTGEIELAYLCNALT-RICPNPNQYLFWDDIHPSQIAYIVISLSLVEQIFHVL 359          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: EXL3_ARATH (GDSL esterase/lipase EXL3 OS=Arabidopsis thaliana GN=EXL3 PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 9.188e-32
Identity = 71/225 (31.56%), Postives = 117/225 (52.00%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            T  L   ISL  QL Y+ EY  K+  + G  +   I+ ++++++ +GS D    YY      + Y  + Y++++ +  S F+  +YG G R+  V   PP+GC+P+ RTL G     C    N  A+ FN K+S    +L+K LP +K +  +I+ P++D++Q+P+  GF E                LCN  +   C + S +VFWDS HP++   +V+   LI
Sbjct:  134 TPKLVAVISLEDQLSYFEEYIEKVKNIVGEARKDFIVANSLFLLVAGSDDIANTYYTLRARPE-YDVDSYTTLMSDSASEFVTKLYGYGVRRVAVFGAPPIGCVPSQRTLGGGILRDCADNYNEAAKLFNSKLSPKLDSLRKTLPGIKPIYINIYDPLFDIIQNPANYGF-EVSNKGCCGTGAIEVAVLCNKITSSVCPDVSTHVFWDSYHPTEKTYKVLVSLLI 356          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL4_ARATH (GDSL esterase/lipase At1g20120 OS=Arabidopsis thaliana GN=At1g20120 PE=2 SV=2)

HSP 1 Score: 134.42 bits (337), Expect = 7.778e-31
Identity = 69/219 (31.51%), Postives = 114/219 (52.05%), Query Frame = 3
Query:   21 AISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            AI +++QL Y++EY  K+    G +++  II   + IV +GS D    YY   L   +Y  + Y+S + +  +SF   +Y  GA+K G   + P+GC+P  RT  G  +  C   +N  AQ FN K+S++   L K + +  +V  DI+    D++Q+P K GF E                LCN  +   C N S ++FWDS HP++ A ++++ + +
Sbjct:  175 AIPMSKQLTYFQEYIEKVKGFVGKEKAEHIISKGLAIVVAGSDDLANTYYGEHLEEFLYDIDTYTSFMASSAASFAMQLYESGAKKIGFIGVSPIGCIPIQRTTRGGLKRKCADELNFAAQLFNSKLSTSLNELAKTMKNTTLVYIDIYSSFNDMIQNPKKYGFDEIDRGCCGTGLLELGP-LCNKYTSLLCKNVSSFMFWDSYHPTERAYKILSQKFV 392          
The following BLAST results are available for this feature:
BLAST of DC899994 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 88
Match NameE-valueIdentityDescription
GDL89_ARATH3.985e-3534.21GDSL esterase/lipase At5g63170 OS=Arabidopsis thal... [more]
GDL26_ARATH3.374e-3435.40GDSL esterase/lipase At1g59030/At1g59406 OS=Arabid... [more]
GDL25_ARATH3.374e-3435.40GDSL esterase/lipase At1g58725 OS=Arabidopsis thal... [more]
EXL1_ARATH3.374e-3434.86GDSL esterase/lipase EXL1 OS=Arabidopsis thaliana ... [more]
GDL24_ARATH1.282e-3334.96GDSL esterase/lipase At1g58480 OS=Arabidopsis thal... [more]
GDL86_ARATH2.856e-3335.16GDSL esterase/lipase At5g45960 OS=Arabidopsis thal... [more]
GDL5_ARATH2.418e-3236.07GDSL esterase/lipase At1g23500 OS=Arabidopsis thal... [more]
GDL1_ARATH2.418e-3232.05GDSL esterase/lipase At1g06990 OS=Arabidopsis thal... [more]
EXL3_ARATH9.188e-3231.56GDSL esterase/lipase EXL3 OS=Arabidopsis thaliana ... [more]
GDL4_ARATH7.778e-3131.51GDSL esterase/lipase At1g20120 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899994 VSS Citrus sinensis cDNA clone VS27Q05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899994 ID=DC899994|Name=DC899994|organism=Citrus sinensis|type=EST|length=854bp
GGACATCCTACTTAAATCATGCAATTTCATTGACTCAGCAGTTGCAGTAC
TATAGAGAGTACCAGAGTAAGCTAGCAAAGGTAGCCGGTAGCAAACAATC
AGCTTCCATAATCAAGGATGCGATATACATAGTGGGTTCTGGGAGTGGTG
ACTTTCTTCAGAATTACTATGTCAATCCTTTACTTAACAAAGTCTACACT
CCTGAGCAGTATAGCTCAATGCTTGTCAATATTTTCTCAAGTTTTATTAA
GAACATGTATGGATTGGGGGCAAGAAAATTTGGAGTGACTTCACTGCCAC
CATTGGGTTGCCTTCCAGCAGCAAGAACTTTATTTGGATATCACGAGAGC
GGCTGTGTCTCTAGAATCAATACTGATGCTCAACAATTTAACAAGAAGGT
CAGCTCCGCAGCAACAAATCTTCAAAAGCAACTTCCTGATCTGAAAATTG
TGATTTTCGACATTTTCAAGCCAATCTATGACCTTGTCCAGTCCCCTTCA
AAATCTGGCTTCGTGGAGGCAACAAGAGGTTGCTGTGGAACAGGAACTGT
AGAAACAACTGTCTTTCTGTGCAATCCAAAGTCGCCTGGAACATGCTCCA
ATGCCTCTCAGTATGTGTTCTGGGACAGTGTTCATCCTTCTCAGGCTGCT
AATCAGGTTATTGCCGATGAATTGATTGTTCAAGGATTTGCCCTTCTCTG
AAGGGGATGTCAAATCCATGGAAATGATCAATATTTCTGTTGAGGCTTCT
TAATCTTCTTGGTGTCTGTGCTTCAGTTTATCAGCTTGTCTATACATCAT
TTTAAGATTTCCTTTGTTTCTTCTAACATTTGCTATATATACATAGTGTT
TTGC
back to top