DC899994

Overview
NameDC899994
Unique NameDC899994
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length854
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1834 contig Csv1_Contig1834:431..1284. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL29_ARATH (GDSL esterase/lipase At1g71691 OS=Arabidopsis thaliana GN=At1g71691 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 3.621e-20
Identity = 61/213 (28.64%), Postives = 99/213 (46.48%), Query Frame = 3
Query:   45 QYYREYQSKLAKVAGSKQSASIIKDAI----YIVGSGSGDFLQNYYVN--PLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIA 665
            Q    +++ L +VA     A  I D++    + +G GS D+L NY +   P  N+ Y  +Q+  +LV  ++  +  +Y LG RKF V  L  +GC+P+   L   ++  C   +N     FN  V +  +NL + LPD K +  DI     D+V + +  G                       ++P  C N  QYVFWD+ HP++  N ++A
Sbjct:  154 QQIHNFETTLDQVASKSGGAVAIADSVTRSLFFIGMGSNDYLNNYLMPNFPTRNQ-YNSQQFGDLLVQHYTDQLTRLYNLGGRKFVVAGLGRMGCIPS--ILAQGNDGKCSEEVNQLVLPFNTNVKTMISNLNQNLPDAKFIYLDIAHMFEDIVANQAAYGLTTMDKGCCGIGKNRGQITCLPFETP--CPNRDQYVFWDAFHPTEKVNLIMA 361          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL82_ARATH (GDSL esterase/lipase At5g45670 OS=Arabidopsis thaliana GN=At5g45670 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 8.067e-20
Identity = 61/220 (27.73%), Postives = 100/220 (45.45%), Query Frame = 3
Query:   12 LNHAISLTQQLQYYREYQSKLAKVAGSKQSAS-IIKDAIYIVGSGSGDFLQNYYVNPLLN--KVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVI 662
            L   I+   Q+  +    S++  + G +  AS  +   IY +G GS D+L NY++    +    ++PE Y+  LV  ++  ++ +Y  GARKF +  +  +GC P            C  RIN+  + FN K+ S      +  PD K    + +    D++ +P++ GF                   C P     C N ++YVFWD+ HP +AAN VI
Sbjct:  121 LGGRIAFAGQVANHVNTVSQVVNILGDQNEASNYLSKCIYSIGLGSNDYLNNYFMPTFYSTGNQFSPESYADDLVARYTEQLRVLYTNGARKFALIGVGAIGCSPNELAQNSRDGRTCDERINSANRIFNSKLISIVDAFNQNTPDAKFTYINAYGIFQDIITNPARYGF-RVTNAGCCGVGRNNGQITCLP-GQAPCLNRNEYVFWDAFHPGEAANIVI 338          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL77_ARATH (GDSL esterase/lipase At5g18430 OS=Arabidopsis thaliana GN=At5g18430 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.376e-19
Identity = 54/220 (24.55%), Postives = 104/220 (47.27%), Query Frame = 3
Query:   24 ISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNP--LLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            I + QQL Y+++YQ +++++ G  Q+  ++  A+ ++  G  DF+ NY++ P    ++ +T   Y  +L++ +   +  +  LG  +  VT   PLGC PA     G     C + +   A  ++ ++      L K++     +  +  +   D + +P + GFV +               LC   S   C N   YVFWD+ HP++ AN++I   ++
Sbjct:  127 IRMYQQLDYFQQYQQRVSRLIGKPQTQRLVSQALVLITVGGNDFVNNYFLFPYSARSRQFTLPDYVRLLISEYKKILLRLNSLGVGRVLVTGAGPLGCAPAELARSGTSNGRCSAELQRAASLYDPQLLQMINELNKKIGRNVFIAANTNQMQEDFLSTPRRYGFVTSKVACCGQGPYNGMG-LCTVLS-NLCPNRELYVFWDAFHPTEKANRMIVRHIL 344          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL36_ARATH (GDSL esterase/lipase At2g19050 OS=Arabidopsis thaliana GN=At2g19050 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.376e-19
Identity = 63/223 (28.25%), Postives = 102/223 (45.74%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNP--LLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIA 665
            + +L   IS  +Q++ +R      AKV   K     +   +Y +  GS D+L NY++    + NK ++ ++Y+  L+  + S++K++Y LGARK  V  +  LGC P      G   +GC + +N   + FNK + +      +   D K    DIF       QSP     +                 LC    P  C    +YV+WD+VH ++AAN V+A
Sbjct:  120 SQHLGEIISFKKQIKNHRS-MIMTAKVPEEK-----LNKCLYTINIGSNDYLNNYFMPAPYMTNKKFSFDEYADSLIRSYRSYLKSLYVLGARKVAVFGVSKLGCTPRMIASHG-GGNGCAAEVNKAVEPFNKNLKALVYEFNRDFADAKFTFVDIFSG-----QSPFAFFMLGFRVTDKSCCTVKPGEELCATNEP-VCPVQRRYVYWDNVHSTEAANMVVA 329          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL67_ARATH (GDSL esterase/lipase At4g28780 OS=Arabidopsis thaliana GN=At4g28780 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.797e-19
Identity = 53/220 (24.09%), Postives = 106/220 (48.18%), Query Frame = 3
Query:   24 ISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPE--QYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            + + +Q + ++EYQ +++++ GS ++  ++  A+ ++  G  DF+ NY+  P+  +       ++S +L++ +   + ++Y LGAR+  VT   PLGC+PA     G     C       A  FN  +      L +++     +  + F    D + +P + GFV +               +C P S   CS+ + Y FWD  HP++ A ++I  +++
Sbjct:  129 LRIGRQFELFQEYQERVSEIIGSDKTQQLVNGALVLMTLGGNDFVNNYFF-PISTRRRQSSLGEFSQLLISEYKKILTSLYELGARRVMVTGTGPLGCVPAELASSGSVNGECAPEAQQAAAIFNPLLVQMLQGLNREIGSDVFIGANAFNTNADFINNPQRFGFVTSKVACCGQGAYNGQG-VCTPLST-LCSDRNAYAFWDPFHPTEKATRLIVQQIM 345          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL37_ARATH (GDSL esterase/lipase At2g19060 OS=Arabidopsis thaliana GN=At2g19060 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 9.862e-18
Identity = 60/224 (26.79%), Postives = 103/224 (45.98%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNP--LLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQK--QLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVI 662
            + +L   IS  +Q+  +R    K+   AG       +K  +Y +  GS D+L NY++      N+ ++ ++Y+  L+  + S++K++Y LGARK  V  +  LGC P      G    GC + +N   + FNKK+    +   +   +   K    D+F       Q+P +   +                 LC    P  C N  +YV+WD+VH ++AAN+V+
Sbjct:  119 SQHLGERISFEKQITNHR----KMIMTAGVPPEK--LKKCLYTINIGSNDYLNNYFMPAPYTTNENFSFDEYADFLIQSYRSYLKSLYVLGARKVAVFGVSKLGCTPRMIASHG-GGKGCATEVNKAVEPFNKKLKDLISEFNRISVVDHAKFTFVDLFSS-----QNPIEYFILGFTVTDKSCCTVESGQELCAANKP-VCPNRERYVYWDNVHSTEAANKVV 329          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL28_ARATH (GDSL esterase/lipase At1g71250 OS=Arabidopsis thaliana GN=At1g71250 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 9.862e-18
Identity = 55/215 (25.58%), Postives = 98/215 (45.58%), Query Frame = 3
Query:   27 SLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKV--YTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIA 665
            SL QQ+       S+L  +   +     +  ++ ++  GS D++ NY +  L +    + P  ++++L++ ++  +  +Y LG RK  +  + PLGC+P  R         CV  +N     FN+ + S    L ++ P    V  + +  I D++ +P+  GF                   C P     C N +QYVFWD+ HP+Q AN ++A
Sbjct:  139 SLNQQMVNLETTLSQLRTMMSPQNFTDYLARSLVVLVFGSNDYINNYLMPNLYDSSIRFRPPDFANLLLSQYARQLLTLYSLGLRKIFIPGVAPLGCIPNQRARGISPPDRCVDSVNQILGTFNQGLKSLVDQLNQRSPGAIYVYGNTYSAIGDILNNPAAYGF-SVVDRACCGIGRNQGQITCLPLQT-PCPNRNQYVFWDAFHPTQTANSILA 351          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GRIP4_ARATH (GDSL esterase/lipase 4 OS=Arabidopsis thaliana GN=GLIP4 PE=2 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 2.197e-17
Identity = 61/231 (26.41%), Postives = 100/231 (43.29%), Query Frame = 3
Query:    6 SYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVE---AXXXXXXXXXXXXXXFLCNP-KSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQG 686
            S  N +  L  QL  ++  +  L    G  ++  +I  A+Y+   G+ D+   ++ N       T E++   ++   ++ I+ +Y LGARKFG  SL P GC P+A  +       C   +       N++       L+++L   K  + D    +   + +PS+ GF E   A              F   P +    C NA  YVF+D  H ++ A+Q IA ELI  G
Sbjct:  132 SVTNLSKDLGTQLNNFKNVEKTLRSNLGDAEARRVISKAVYLFHIGANDYQYPFFANTSTFSNTTKERFIDFVIGNTTTVIEELYKLGARKFGFLSLGPFGCTPSALIINSTKIGSCFEPVTELINLHNQEFPKVLRRLERRLSGFKYALHDFHTSLSQRINNPSRYGFKEGEMACCGSGPLRGINTCGFRNGPSQGYKLCENADDYVFFDPSHLTETAHQQIA-ELIWSG 361          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GLIP3_ARATH (GDSL esterase/lipase 3 OS=Arabidopsis thaliana GN=GLIP3 PE=2 SV=2)

HSP 1 Score: 88.9669 bits (219), Expect = 3.747e-17
Identity = 58/231 (25.11%), Postives = 98/231 (42.42%), Query Frame = 3
Query:    6 SYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSP----GTCSNASQYVFWDSVHPSQAANQVIADELIVQG 686
            S+L   I+L  QL  +++ +  L    G  ++  +   A+Y+   G+ D+   +  N    K  + E++   ++   +  I+ +Y +G RKFG  ++ P  C P +          C   +       NKK       LQ+QL   +  + D    + + + SPSK GF E                  N   P    G C N + Y+F+DS H ++ A++ IA ELI  G
Sbjct:  119 SFLGMVINLGTQLNNFKDVEKSLRSELGDAETKRVFSRAVYLFHIGANDYFYPFSANSSTFKSNSKEKFVDFVIGNITFVIEEVYKMGGRKFGFLNVGPYECSPNSLIRDRTKIGSCFKPVAELIDMHNKKFPDVLRRLQRQLSGFRYALHDYHTSLSERINSPSKYGFKEGKKACCGSGPLRGINTCGNRIGPSQGYGLCENVTDYLFYDSSHLTEKAHRQIA-ELIWNG 348          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL75_ARATH (GDSL esterase/lipase At5g08460 OS=Arabidopsis thaliana GN=At5g08460 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.424e-16
Identity = 53/224 (23.66%), Postives = 102/224 (45.54%), Query Frame = 3
Query:    9 YLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLL--NKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIF---DIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIA 665
            +L    S+ +Q++ + +   ++++    +     +  ++ +V  G+ D++ NY    L   + +Y P  ++ +L++ F++ +  +YG G RKF +  + PLGC+P            CV  +N  A+ FN ++ S    L          IF   + +    D++ +P   GF E                 C P +   C+   ++VFWD+ HP+QA N +IA
Sbjct:  142 HLGERFSMGRQVENFEKTLMEISRSMRKESVKEYMAKSLVVVSLGNNDYINNYLKPRLFLSSSIYDPTSFADLLLSNFTTHLLELYGKGFRKFVIAGVGPLGCIPDQLAAQAALPGECVEAVNEMAELFNNRLVSLVDRLNSDNKTASEAIFVYGNTYGAAVDILTNPFNYGF-EVTDRGCCGVGRNRGEITCLPLAV-PCAFRDRHVFWDAFHPTQAFNLIIA 363          
The following BLAST results are available for this feature:
BLAST of DC899994 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 88
Match NameE-valueIdentityDescription
GDL29_ARATH3.621e-2028.64GDSL esterase/lipase At1g71691 OS=Arabidopsis thal... [more]
GDL82_ARATH8.067e-2027.73GDSL esterase/lipase At5g45670 OS=Arabidopsis thal... [more]
GDL77_ARATH1.376e-1924.55GDSL esterase/lipase At5g18430 OS=Arabidopsis thal... [more]
GDL36_ARATH1.376e-1928.25GDSL esterase/lipase At2g19050 OS=Arabidopsis thal... [more]
GDL67_ARATH1.797e-1924.09GDSL esterase/lipase At4g28780 OS=Arabidopsis thal... [more]
GDL37_ARATH9.862e-1826.79GDSL esterase/lipase At2g19060 OS=Arabidopsis thal... [more]
GDL28_ARATH9.862e-1825.58GDSL esterase/lipase At1g71250 OS=Arabidopsis thal... [more]
GRIP4_ARATH2.197e-1726.41GDSL esterase/lipase 4 OS=Arabidopsis thaliana GN=... [more]
GLIP3_ARATH3.747e-1725.11GDSL esterase/lipase 3 OS=Arabidopsis thaliana GN=... [more]
GDL75_ARATH1.424e-1623.66GDSL esterase/lipase At5g08460 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899994 VSS Citrus sinensis cDNA clone VS27Q05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899994 ID=DC899994|Name=DC899994|organism=Citrus sinensis|type=EST|length=854bp
GGACATCCTACTTAAATCATGCAATTTCATTGACTCAGCAGTTGCAGTAC
TATAGAGAGTACCAGAGTAAGCTAGCAAAGGTAGCCGGTAGCAAACAATC
AGCTTCCATAATCAAGGATGCGATATACATAGTGGGTTCTGGGAGTGGTG
ACTTTCTTCAGAATTACTATGTCAATCCTTTACTTAACAAAGTCTACACT
CCTGAGCAGTATAGCTCAATGCTTGTCAATATTTTCTCAAGTTTTATTAA
GAACATGTATGGATTGGGGGCAAGAAAATTTGGAGTGACTTCACTGCCAC
CATTGGGTTGCCTTCCAGCAGCAAGAACTTTATTTGGATATCACGAGAGC
GGCTGTGTCTCTAGAATCAATACTGATGCTCAACAATTTAACAAGAAGGT
CAGCTCCGCAGCAACAAATCTTCAAAAGCAACTTCCTGATCTGAAAATTG
TGATTTTCGACATTTTCAAGCCAATCTATGACCTTGTCCAGTCCCCTTCA
AAATCTGGCTTCGTGGAGGCAACAAGAGGTTGCTGTGGAACAGGAACTGT
AGAAACAACTGTCTTTCTGTGCAATCCAAAGTCGCCTGGAACATGCTCCA
ATGCCTCTCAGTATGTGTTCTGGGACAGTGTTCATCCTTCTCAGGCTGCT
AATCAGGTTATTGCCGATGAATTGATTGTTCAAGGATTTGCCCTTCTCTG
AAGGGGATGTCAAATCCATGGAAATGATCAATATTTCTGTTGAGGCTTCT
TAATCTTCTTGGTGTCTGTGCTTCAGTTTATCAGCTTGTCTATACATCAT
TTTAAGATTTCCTTTGTTTCTTCTAACATTTGCTATATATACATAGTGTT
TTGC
back to top