DC899994

Overview
NameDC899994
Unique NameDC899994
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length854
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1834 contig Csv1_Contig1834:431..1284. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL60_ARATH (GDSL esterase/lipase At3g62280 OS=Arabidopsis thaliana GN=At3g62280 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 3.878e-14
Identity = 61/234 (26.07%), Postives = 101/234 (43.16%), Query Frame = 3
Query:   21 AISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTP--EQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHES-----GCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVE---AXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFA 692
            AI + Q + +    Q  ++         +  ++A+Y++  G  D L   Y +   N  Y P  E+  SML+ I  + I+ +Y  G RKF V +  PLGC P    +  +++S     GC    N  A+ FNK + S    L+ Q  D  +V  DI+   Y L       GFV+   A                C       C + ++ + WD VH ++AAN+ + D ++   ++
Sbjct:  126 AIQIRQFVHFKNRSQELISSGRRDLIDDNGFRNALYMIDIGQNDLLLALYDS---NLTYAPVVEKIPSMLLEIKKA-IQTVYLYGGRKFWVHNTGPLGCAPKELAIHLHNDSDLDPIGCFRVHNEVAKAFNKGLLSLCNELRSQFKDATLVYVDIYSIKYKLSADFKLYGFVDPLMACCGYGGRPNNYDRKATCGQPGSTICRDVTKAIVWDGVHYTEAANRFVVDAVLTNRYS 355          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: EST_HEVBR (Esterase OS=Hevea brasiliensis PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 5.065e-14
Identity = 54/172 (31.40%), Postives = 74/172 (43.02%), Query Frame = 3
Query:  222 LVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHE---SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSP------------GTCSNASQYVFWDSVHPSQAANQVIADELIVQGFA 692
            LVN FS+ +K +Y LGAR F + +  P+GCL    T F + E   +GC    N  AQ FN K+      L+K LP    V  DI+   Y L   P K GF E                +  P               G+C+  S  V WD  H ++AAN+   D++    F+
Sbjct:  199 LVNSFSANVKKIYDLGARTFWIHNTGPIGCLSFILTYFPWAEKDSAGCAKAYNEVAQHFNHKLKEIVAQLRKDLPLATFVHVDIYSVKYSLFSEPEKHGF-EFPLITCCGYGGKYNFSVTAPCGDTVTADDGTKIVVGSCACPSVRVNWDGAHYTEAANEYFFDQISTGAFS 369          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GLIP6_ARATH (GDSL esterase/lipase 6 OS=Arabidopsis thaliana GN=GLIP6 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.128e-13
Identity = 44/190 (23.16%), Postives = 92/190 (48.42%), Query Frame = 3
Query:  105 SIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADEL 674
            SII+++++++ +GS D   NY++ P      +P+ Y + +++  +  I  +Y LGAR+    SL P+GC+PA   L     + C  ++N  A+ +NK++      +  + P    V   ++   +     P++ GF +                 C  +    C+N ++++FWD  HP++   ++++  L
Sbjct:  153 SIIQESLFLLETGSNDIF-NYFL-PFRAPTLSPDAYVNAMLDQVNKTIDQIYKLGARRIAFFSLGPVGCVPARAMLPNAPTNKCFGKMNVMAKMYNKRLEDIVNIIPTKYPGAIAVFGAVYGITHRFQTYPARYGFSDV-SNACCGNGTLGGLMQCGREGYKICNNPNEFLFWDFYHPTEHTYRLMSKAL 339          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL6_ARATH (GDSL esterase/lipase At1g28570 OS=Arabidopsis thaliana GN=At1g28570 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.128e-13
Identity = 53/235 (22.55%), Postives = 108/235 (45.96%), Query Frame = 3
Query:   24 ISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGS-GSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHE-------SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKS---PGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFAL 695
            +SL  QL  ++E    L           +I++++ ++G  G  D+   ++V   + ++   ++   +++   SS I  + G+G + F V    PLGC  A  +L+           +GC+  +N  ++  ++++ +    LQK  P + I+  D +  +  L Q P+K GF+                 L   +    P  C + S+YV WD VH ++AA +++A+ ++   +A+
Sbjct:  138 VSLAVQLSSFKESLPNLC--VSPSDCRDMIENSLILMGEIGGNDYNYAFFVGKNIEEI---KELVPLVIETISSAITELIGMGGKTFLVPGEFPLGCSVAYLSLYQTSNIEEYDPLTGCLKWLNKFSEYHDEQLQAELNRLQKLYPHVNIIYADYYNTLLRLAQEPAKFGFISRPLPACCALGGPFNFTLGRKRGTQVPECCDDPSKYVSWDGVHMTEAAYRLMAEGILKGPYAI 367          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GLIP2_ARATH (GDSL esterase/lipase 2 OS=Arabidopsis thaliana GN=GLIP2 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.925e-13
Identity = 56/226 (24.78%), Postives = 94/226 (41.59%), Query Frame = 3
Query:   24 ISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCN-----PKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQG 686
            I+L  QL  +++ +  L    G  Q   +I  A+Y+   G  D+   +  N  + +    E Y   +V   ++ IK +Y +G RKFG  ++    C PA+  +       C   +       N+K+ S    L+++L   K  + D    +   + +PSK GF E                 C       +S   C   + Y+F+D  H ++ A+Q IA ELI  G
Sbjct:  136 INLKSQLNNFKKVEKLLRSTLGEAQGKMVISRAVYLFHIGVNDYQYPFSTNSSIFQSSPQEIYVDFVVGNTTAVIKEVYKIGGRKFGFLNMGAYDCAPASLIIDQTKIGTCFKPVTELINLHNEKLESGLRRLERELSGFKYALHDYHTSLSVRMNNPSKYGFKEGKMACCGTGPLRGIN-TCGGRMGVSQSYELCEKVTDYLFFDHFHLTEKAHQQIA-ELIWSG 359          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL12_ARATH (GDSL esterase/lipase At1g28660 OS=Arabidopsis thaliana GN=At1g28660 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.514e-13
Identity = 55/229 (24.02%), Postives = 98/229 (42.79%), Query Frame = 3
Query:   24 ISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGS-GSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHE-------SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFL---CNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            +SL  QL  +++    L   + S+    ++ D++ ++G  G  DF         +N+     +   +++   SS I ++  LG + F V    P GC  A  T +           +GC+ R+N   +  N+++ +    LQK  PD+ I+  D    +Y   Q P+K GF                  +   C  +    C N S+YV WD  H ++AA Q +A+ ++
Sbjct:  139 VSLGVQLDIFKQILPNLC-ASSSRDCREMLGDSLILMGEIGGNDFFYPSSEGKSINET----KLQDLIIKAISSAIVDLIALGGKTFLVPGGFPAGCSAACLTQYQNATEEDYDPLTGCIPRLNELGEHDNEQLKTELKRLQKLYPDVNIIYADYHNSLYRFYQEPAKYGFKNKPLAACCGVGGKYNFTIGKECGYEGVSYCQNPSEYVNWDGYHLTEAAYQKMAEGIL 362          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL49_ARATH (GDSL esterase/lipase At3g05180 OS=Arabidopsis thaliana GN=At3g05180 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 4.288e-13
Identity = 58/208 (27.88%), Postives = 93/208 (44.71%), Query Frame = 3
Query:   99 SASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSM---LVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHES-----GCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGF---VEAXXXXXXXXXXXXXXFLC--NPKSPGT------CSNASQYVFWDSVHPSQAANQVIA 665
            S     + +Y+   G  D    +Y         T +Q  ++   +++IF   IK +Y  GAR + + +  PLGCL    ++FG  +S     GCVS  N  A+ FN ++      L +Q P+ +    DIF    DL+ + SK GF   +                  C    +S GT      C ++S+YV WD +H ++AAN+ +A
Sbjct:  162 SEYFFSNGLYMFDIGQNDIAGAFYTK-------TVDQVLALVPIILDIFQDGIKRLYAEGARNYWIHNTGPLGCLAQVVSIFGEDKSKLDEFGCVSDHNQAAKLFNLQLHGLFKKLPQQYPNSRFTYVDIFSIKSDLILNHSKYGFDHSIMVCCGTGGPPLNYDDQVGCGKTARSNGTIITAKPCYDSSKYVNWDGIHYTEAANRFVA 362          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL40_ARATH (GDSL esterase/lipase At2g27360 OS=Arabidopsis thaliana GN=At2g27360 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 4.288e-13
Identity = 60/236 (25.42%), Postives = 107/236 (45.34%), Query Frame = 3
Query:   24 ISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPE--QYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHE-------SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFL---CNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFAL 695
            ISL  QL+ ++E    L   + S     +I++A  ++G   G    N Y  PL ++    E  +   +++   SS I  +  +GAR F V    PLGC  A  TL+           +GC++ +N  +   N+++ +    L+   P + I+  D +  +  L+Q PSK G ++                    C  K    CS+ S+YV WD +H ++AA + I++ ++   +A+
Sbjct:  137 ISLGNQLKSFKESLPYLCG-SSSPDCRDMIENAFILIGEIGG----NDYNFPLFDRKNIEEVKELVPLVITTISSAISELVDMGARTFLVPGNFPLGCSVAYLTLYETPNKEEYNPLTGCLTWLNDFSVYHNEQLQAELKRLRNLYPHVNIIYGDYYNTLLRLMQEPSKFGLMDRPLPACCGLGGPYNFTFSIKCGSKGVEYCSDPSKYVNWDGIHMTEAAYKWISEGVLTGPYAI 367          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL7_ARATH (GDSL esterase/lipase At1g28580 OS=Arabidopsis thaliana GN=At1g28580 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 7.314e-13
Identity = 54/236 (22.88%), Postives = 108/236 (45.76%), Query Frame = 3
Query:   24 ISLTQQLQYYREYQSKLAKVAGSKQSA-SIIKDAIYIVGS-GSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHE-------SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFL---CNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFAL 695
            +SL  QL  ++E    L  + GS      +I++A+ ++G  G  D+   ++V+  + ++   ++   +++   SS I  + G+G R F V    P+GC     T             +GC+  +N   +   +++ +    LQK  P + I+  D +  ++ L Q P+K GF+                 +   C      +C + S+YV WD VH ++AA +++A+ ++   +A+
Sbjct:  141 VSLGVQLNSFKE---SLPSICGSPSDCRDMIENALILMGEIGGNDYNYAFFVDKGIEEI---KELMPLVITTISSAITELIGMGGRTFLVPGEFPVGCSVLYLTSHQTSNMEEYDPLTGCLKWLNKFGENHGEQLRAELNRLQKLYPHVNIIYADYYNALFHLYQEPAKFGFMNRPLSACCGAGGPYNYTVGRKCGTDIVESCDDPSKYVAWDGVHMTEAAYRLMAEGILNGPYAI 370          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL87_ARATH (GDSL esterase/lipase At5g55050 OS=Arabidopsis thaliana GN=At5g55050 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.248e-12
Identity = 54/225 (24.00%), Postives = 108/225 (48.00%), Query Frame = 3
Query:   12 LNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFG-YHESGCVSRINTDAQQFNKKVSSAATNLQKQLP-DLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSV-HPSQAANQVIADELI 677
            L  AI L++Q+  +     ++ K+  S     + K +++ V  GS D L +Y+ +  L +   P+QY+ ++ +     +K ++  GAR+F +  +  +GC P  R      HE  C    N     +N+ +      L+++L   +    FD +K ++D++ +P++ GF +                 C P +   CS+ ++++FWD   HP++AA + I D ++
Sbjct:  140 LGQAIPLSKQVNNWLSIHEEVMKLEPSAAQLHLSK-SLFTVVIGSND-LFDYFGSFKLRRQSNPQQYTQLMADKLKEQLKRIHDSGARRFLIIGVAQIGCTPGKRAKNSTLHE--CDEGANMWCSLYNEALVKMLQQLKQELQGSITYTYFDNYKSLHDIISNPARYGFADV-TSACCGNGELNADLPCLPLAK-LCSDRTKHLFWDRYGHPTEAAARTIVDLML 358          
The following BLAST results are available for this feature:
BLAST of DC899994 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 88
Match NameE-valueIdentityDescription
GDL60_ARATH3.878e-1426.07GDSL esterase/lipase At3g62280 OS=Arabidopsis thal... [more]
EST_HEVBR5.065e-1431.40Esterase OS=Hevea brasiliensis PE=1 SV=1[more]
GLIP6_ARATH1.128e-1323.16GDSL esterase/lipase 6 OS=Arabidopsis thaliana GN=... [more]
GDL6_ARATH1.128e-1322.55GDSL esterase/lipase At1g28570 OS=Arabidopsis thal... [more]
GLIP2_ARATH1.925e-1324.78GDSL esterase/lipase 2 OS=Arabidopsis thaliana GN=... [more]
GDL12_ARATH2.514e-1324.02GDSL esterase/lipase At1g28660 OS=Arabidopsis thal... [more]
GDL49_ARATH4.288e-1327.88GDSL esterase/lipase At3g05180 OS=Arabidopsis thal... [more]
GDL40_ARATH4.288e-1325.42GDSL esterase/lipase At2g27360 OS=Arabidopsis thal... [more]
GDL7_ARATH7.314e-1322.88GDSL esterase/lipase At1g28580 OS=Arabidopsis thal... [more]
GDL87_ARATH1.248e-1224.00GDSL esterase/lipase At5g55050 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899994 VSS Citrus sinensis cDNA clone VS27Q05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899994 ID=DC899994|Name=DC899994|organism=Citrus sinensis|type=EST|length=854bp
GGACATCCTACTTAAATCATGCAATTTCATTGACTCAGCAGTTGCAGTAC
TATAGAGAGTACCAGAGTAAGCTAGCAAAGGTAGCCGGTAGCAAACAATC
AGCTTCCATAATCAAGGATGCGATATACATAGTGGGTTCTGGGAGTGGTG
ACTTTCTTCAGAATTACTATGTCAATCCTTTACTTAACAAAGTCTACACT
CCTGAGCAGTATAGCTCAATGCTTGTCAATATTTTCTCAAGTTTTATTAA
GAACATGTATGGATTGGGGGCAAGAAAATTTGGAGTGACTTCACTGCCAC
CATTGGGTTGCCTTCCAGCAGCAAGAACTTTATTTGGATATCACGAGAGC
GGCTGTGTCTCTAGAATCAATACTGATGCTCAACAATTTAACAAGAAGGT
CAGCTCCGCAGCAACAAATCTTCAAAAGCAACTTCCTGATCTGAAAATTG
TGATTTTCGACATTTTCAAGCCAATCTATGACCTTGTCCAGTCCCCTTCA
AAATCTGGCTTCGTGGAGGCAACAAGAGGTTGCTGTGGAACAGGAACTGT
AGAAACAACTGTCTTTCTGTGCAATCCAAAGTCGCCTGGAACATGCTCCA
ATGCCTCTCAGTATGTGTTCTGGGACAGTGTTCATCCTTCTCAGGCTGCT
AATCAGGTTATTGCCGATGAATTGATTGTTCAAGGATTTGCCCTTCTCTG
AAGGGGATGTCAAATCCATGGAAATGATCAATATTTCTGTTGAGGCTTCT
TAATCTTCTTGGTGTCTGTGCTTCAGTTTATCAGCTTGTCTATACATCAT
TTTAAGATTTCCTTTGTTTCTTCTAACATTTGCTATATATACATAGTGTT
TTGC
back to top