DC899993

Overview
NameDC899993
Unique NameDC899993
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length528
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13L_TOBAC (Glucan endo-1,3-beta-glucosidase, acidic isoform GL153 OS=Nicotiana tabacum GN=GGL4 PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 7.506e-25
Identity = 59/126 (46.83%), Postives = 82/126 (65.08%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGV-EQNFGFFYPNMQPIY 380
            + L YALF  +          Y NLFDA++D+ + A+EK   PNV + +SESGWPS GN   T IENAQ Y +NL+DHV  G GTP++PG++ +T+LF MF+EN K   + E++FG F P+ +  Y
Sbjct:  218 VPLSYALFTQRGKNSAG----YQNLFDAILDSMYFAVEKAGGPNVEIIVSESGWPSEGNSAAT-IENAQTYYRNLIDHVKRGAGTPKKPGKSIETYLFAMFDENVKKGEITEKHFGLFSPDQRAKY 338          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E132_ARATH (Glucan endo-1,3-beta-glucosidase 2 OS=Arabidopsis thaliana GN=At1g66250 PE=1 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 9.803e-25
Identity = 57/131 (43.51%), Postives = 84/131 (64.12%), Query Frame = 3
Query:    6 ISLDYALFQ----SKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAG--NEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGVEQNFGFFYPNMQPIY 380
            I LDYALF+    +K+ V  +    Y N FDAMVDA + A+  ++  N+ + ++ESGWPS G  NEP  +++NA  YN NL+ HVL   GTP+RPG    T+++E++NE+ K    E+N+G F  N +P+Y
Sbjct:  218 IPLDYALFKPIPPNKEAVDANTLVRYSNAFDAMVDATYFAMAFLNFTNIPVLVTESGWPSKGETNEPDATLDNANTYNSNLIRHVLNKTGTPKRPGIAVSTYIYELYNEDTKAGLSEKNWGLFNANGEPVY 348          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13B_SOLLC (Glucan endo-1,3-beta-glucosidase B OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.280e-24
Identity = 60/125 (48.00%), Postives = 85/125 (68.00%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGVEQNFGFFYPNMQPIY 380
            ISL YALF + + VV+DG   Y NLFDAM+D+ ++A+++    +V + +SESGWPSAG    T  ENAQ Y +NL+ H    +G+PR+PG   +T++F MF+EN K   +E++FG F PN QP Y
Sbjct:  215 ISLPYALFTAPNVVVQDGSRQYRNLFDAMLDSVYAAMDRTGGGSVGIVVSESGWPSAGAFGATH-ENAQTYLRNLIQH--AKEGSPRKPG-PIETYIFAMFDENNKNPELEKHFGMFSPNKQPKY 335          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E133_ARATH (Glucan endo-1,3-beta-glucosidase 3 OS=Arabidopsis thaliana GN=At2g01630 PE=1 SV=2)

HSP 1 Score: 112.079 bits (279), Expect = 1.672e-24
Identity = 56/132 (42.42%), Postives = 85/132 (64.39%), Query Frame = 3
Query:    6 ISLDYALFQ----SKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAG--NEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGV-EQNFGFFYPNMQPIY 380
            I LDYALFQ    +K+ V  +    Y N+FDA+VDA + A+  ++  N+ + ++ESGWPS G  +E   ++ENA  YN NL+ HV+   GTP+ PG    T+++E++NE+ +P  V E+N+G FY N  P+Y
Sbjct:  209 IPLDYALFQPLQANKEAVDANTLLHYTNVFDAIVDAAYFAMSYLNFTNIPIVVTESGWPSKGGPSEHDATVENANTYNSNLIQHVINKTGTPKHPGTAVTTYIYELYNEDTRPGPVSEKNWGLFYTNGTPVY 340          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E1312_ARATH (Glucan endo-1,3-beta-glucosidase 12 OS=Arabidopsis thaliana GN=At4g29360 PE=1 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 2.184e-24
Identity = 58/129 (44.96%), Postives = 80/129 (62.02%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGP-YLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSI--ENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPA-GVEQNFGFFYPNMQPIY 380
            + L+YALF+S   VV      LY N+FDA +DA + AL  +    V + ++ESGWPS G+   T+   ENA  YN NL+ HV+G  GTP +PG+  D +LF +FNEN+KP    E+N+G FY N   +Y
Sbjct:  213 VPLEYALFESSSQVVDPATGLLYSNMFDAQLDAIYFALTAMSFKTVKVMVTESGWPSKGSPKETAATPENALAYNTNLIRHVIGDPGTPAKPGEEIDVYLFSLFNENRKPGIESERNWGMFYANGTNVY 341          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E131_SOLTU (Glucan endo-1,3-beta-glucosidase, basic isoform 1 (Fragment) OS=Solanum tuberosum GN=GLUB1 PE=2 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 3.725e-24
Identity = 59/125 (47.20%), Postives = 84/125 (67.20%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGVEQNFGFFYPNMQPIY 380
            ISL YALF + + VV+DG   Y NLFDAM+D+ ++A+E+    +V + +SESGWPSAG    T  +NA  Y +NL+ H    +G+PR+PG   +T++F MF+EN K   +E++FG F PN QP Y
Sbjct:  189 ISLPYALFTAPNAVVQDGSRQYRNLFDAMLDSVYAAMERTGGGSVGIVVSESGWPSAGAFGATQ-DNAATYLRNLIQH--AKEGSPRKPG-PIETYIFAMFDENNKNPELEKHFGLFSPNKQPKY 309          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E133_SOLTU (Glucan endo-1,3-beta-glucosidase, basic isoform 3 (Fragment) OS=Solanum tuberosum GN=GLUB3 PE=2 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 4.865e-24
Identity = 59/125 (47.20%), Postives = 84/125 (67.20%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGVEQNFGFFYPNMQPIY 380
            ISL YALF + + VV+DG   Y NLFDAM+D+ ++A+E+    +V + +SESGWPSAG    T  +NA  Y +NL+ H    +G+PR+PG   +T++F MF+EN K   +E++FG F PN QP Y
Sbjct:  180 ISLPYALFTAPNVVVQDGSRQYRNLFDAMLDSVYAAMERTGGGSVGIVVSESGWPSAGAFGATQ-DNAATYLRNLIQH--AKEGSPRKPG-PIETYIFAMFDENNKNPELEKHFGLFSPNKQPKY 300          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13F_TOBAC (Glucan endo-1,3-beta-glucosidase, basic vacuolar isoform GLB OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 8.299e-24
Identity = 59/125 (47.20%), Postives = 84/125 (67.20%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGVEQNFGFFYPNMQPIY 380
            ISL Y+LF + + VV+DG   Y NLFDAM+D+ ++ALE+    +V + +SESGWPSAG    T  +NA  Y +NL+ H    +G+PR+PG   +T++F MF+EN K   +E++FG F PN QP Y
Sbjct:  223 ISLPYSLFTAPNVVVQDGSRQYRNLFDAMLDSVYAALERSGGASVGIVVSESGWPSAGAFGAT-YDNAATYLRNLIQH--AKEGSPRKPG-PIETYIFAMFDENNKNPELEKHFGLFSPNKQPKY 343          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13E_TOBAC (Glucan endo-1,3-beta-glucosidase, basic vacuolar isoform GGIB50 OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 8.299e-24
Identity = 59/125 (47.20%), Postives = 84/125 (67.20%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGVEQNFGFFYPNMQPIY 380
            ISL Y+LF + + VV+DG   Y NLFDAM+D+ ++ALE+    +V + +SESGWPSAG    T  +NA  Y +NL+ H    +G+PR+PG   +T++F MF+EN K   +E++FG F PN QP Y
Sbjct:  223 ISLPYSLFTAPNVVVQDGSRQYRNLFDAMLDSVYAALERSGGASVGIVVSESGWPSAGAFGAT-YDNAATYLRNLIQH--AKEGSPRKPG-PIETYIFAMFDENNKNPELEKHFGLFSPNKQPKY 343          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13B_TOBAC (Glucan endo-1,3-beta-glucosidase, basic vacuolar isoform OS=Nicotiana tabacum PE=1 SV=2)

HSP 1 Score: 109.768 bits (273), Expect = 8.299e-24
Identity = 59/125 (47.20%), Postives = 84/125 (67.20%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGVEQNFGFFYPNMQPIY 380
            ISL Y+LF + + VV+DG   Y NLFDAM+D+ ++ALE+    +V + +SESGWPSAG    T  +NA  Y +NL+ H    +G+PR+PG   +T++F MF+EN K   +E++FG F PN QP Y
Sbjct:  224 ISLPYSLFTAPNVVVQDGSRQYRNLFDAMLDSVYAALERSGGASVGIVVSESGWPSAGAFGAT-YDNAATYLRNLIQH--AKEGSPRKPG-PIETYIFAMFDENNKNPELEKHFGLFSPNKQPKY 344          
The following BLAST results are available for this feature:
BLAST of DC899993 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 49
Match NameE-valueIdentityDescription
E13L_TOBAC7.506e-2546.83Glucan endo-1,3-beta-glucosidase, acidic isoform G... [more]
E132_ARATH9.803e-2543.51Glucan endo-1,3-beta-glucosidase 2 OS=Arabidopsis ... [more]
E13B_SOLLC1.280e-2448.00Glucan endo-1,3-beta-glucosidase B OS=Solanum lyco... [more]
E133_ARATH1.672e-2442.42Glucan endo-1,3-beta-glucosidase 3 OS=Arabidopsis ... [more]
E1312_ARATH2.184e-2444.96Glucan endo-1,3-beta-glucosidase 12 OS=Arabidopsis... [more]
E131_SOLTU3.725e-2447.20Glucan endo-1,3-beta-glucosidase, basic isoform 1 ... [more]
E133_SOLTU4.865e-2447.20Glucan endo-1,3-beta-glucosidase, basic isoform 3 ... [more]
E13F_TOBAC8.299e-2447.20Glucan endo-1,3-beta-glucosidase, basic vacuolar i... [more]
E13E_TOBAC8.299e-2447.20Glucan endo-1,3-beta-glucosidase, basic vacuolar i... [more]
E13B_TOBAC8.299e-2447.20Glucan endo-1,3-beta-glucosidase, basic vacuolar i... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899993 VSS Citrus sinensis cDNA clone VS27Q04 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899993 ID=DC899993|Name=DC899993|organism=Citrus sinensis|type=EST|length=528bp
CTCACATATCCTTAGACTATGCCTTATTTCAGTCGAAAGATCCTGTAGTT
AGAGACGGGCCATACTTGTATTATAATCTATTTGATGCCATGGTTGATGC
TTTTCACTCAGCTCTGGAGAAGATTGATGTACCGAATGTGACTTTGGCCA
TATCAGAGTCAGGATGGCCTAGTGCTGGCAATGAGCCTTATACAAGCATA
GAAAATGCACAAAAATATAATAAGAACTTGATGGATCATGTCTTGGGAGG
AAAAGGGACTCCGAGGAGGCCAGGTCAAACTTTTGATACATTTTTATTTG
AGATGTTCAATGAGAATCAAAAGCCTGCTGGGGTTGAGCAGAATTTCGGA
TTCTTCTATCCAAATATGCAGCCAATTTATCCATTTTGGCCATGCTAGAA
GCATTTATCTTTTACTTATACTGCTGTAATGTAAGCGTGGTGCCTAATTT
GAAAAAGTAACTTATGAAGCAAGTTACACCTTTGCTTTTGCTAAGTAATA
AAAGAATAGATAGTANTTAATTAAAAAA
back to top