DC899993

Overview
NameDC899993
Unique NameDC899993
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length528
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: EA6_ARATH (Probable glucan endo-1,3-beta-glucosidase A6 OS=Arabidopsis thaliana GN=A6 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.115e-19
Identity = 55/130 (42.31%), Postives = 78/130 (60.00%), Query Frame = 3
Query:    9 SLDYALFQSKDPVVRDGPYLYY-NLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAG--NEPYTSIENAQKYNKNLMDHVLGGK--GTPRRPGQTFDTFLFEMFNENQKP-AGVEQNFGFFYPNMQPIY 380
            SLD+ALFQ           L Y NL D M+D+   A+ K+  P++ LAISE+GWP+ G  +E   +I NA  YN+NL+  +      GTP RPG    TF+F +FNENQK  +G ++++G  +P+  PIY
Sbjct:  230 SLDFALFQGHSTYTDPQTGLVYRNLLDQMLDSVLFAMTKLGYPHMRLAISETGWPNFGDIDETGANILNAATYNRNLIKKMSASPPIGTPSRPGLPIPTFVFSLFNENQKSGSGTQRHWGILHPDGSPIY 359          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13B_WHEAT (Glucan endo-1,3-beta-glucosidase OS=Triticum aestivum GN=GLC1 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 3.608e-19
Identity = 45/128 (35.16%), Postives = 79/128 (61.72%), Query Frame = 3
Query:    9 SLDYALFQSKDPVVRDGPYLYY-NLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPY--TSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGV-EQNFGFFYPNMQPIY 380
            +L+YALF+    +      L Y ++ DA +DA ++A++K+   +V +A+ E+GWP+          ++ A+ +N+ ++     GKGTP  P +TF+T+LF +F+ENQKP  + E++FG F P+  P+Y
Sbjct:  215 TLNYALFRPNSGIYDPATKLNYTSMLDAQMDAIYTAMKKLGYGDVDIAVGEAGWPTQAEPGQIGVGVQEARDFNEGMIRVCSSGKGTPLMPNRTFETYLFSLFDENQKPGPIAERHFGLFNPDFTPVY 342          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E136_ARATH (Glucan endo-1,3-beta-glucosidase 6 OS=Arabidopsis thaliana GN=At5g58090 PE=1 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 1.371e-18
Identity = 50/126 (39.68%), Postives = 72/126 (57.14%), Query Frame = 3
Query:   12 LDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQK---PAGVEQNFGFFYPNMQPIY 380
            +DYA F      + DG   YYN+FDA  D    ALEK    N+ + I E GWP+ G +   +++ A+K+N+  M H+ GGKGTPRRPG   D +LF + +E+ K   P   E+++G F  +  P Y
Sbjct:  214 VDYAFFDGNAQPLNDGGTFYYNMFDANYDTLVHALEKNGFGNMPIIIGEIGWPTDG-DSNANLDYAKKFNQGFMAHISGGKGTPRRPG-PIDAYLFSLIDEDAKSVQPGYFERHWGIFTFDGLPKY 337          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E137_ARATH (Glucan endo-1,3-beta-glucosidase 7 OS=Arabidopsis thaliana GN=At4g34480 PE=1 SV=2)

HSP 1 Score: 91.6633 bits (226), Expect = 2.339e-18
Identity = 45/107 (42.06%), Postives = 67/107 (62.62%), Query Frame = 3
Query:   69 YYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAG--NEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPA-GVEQNFGFFYPNMQPIY 380
            Y N+FDA VDA HSAL+ +    V + ++E+GW S G  NE   S++NA+ YN NL+ H+    GTP  PG+  DT++F +++EN KP    E+ FG F  ++  +Y
Sbjct:  235 YTNMFDAQVDAVHSALKSMGFEKVEIVVAETGWASRGDANEVGASVDNAKAYNGNLIAHLRSMVGTPLMPGKPVDTYIFALYDENLKPGPSSERAFGLFKTDLSMVY 341          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13B_SOYBN (Glucan endo-1,3-beta-glucosidase (Fragment) OS=Glycine max PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.161e-17
Identity = 48/107 (44.86%), Postives = 66/107 (61.68%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLF-EMFNENQK 323
            I L YALF  +     +    Y NLFDAM+D+ ++ALE +   N+ + +SESGWPS G     SI+NA  Y  NL+ H   G GTP+RPG++ +T+LF    +ENQK
Sbjct:  137 IPLAYALFTQQG----NNDVGYQNLFDAMLDSIYAALENVGASNLQIVVSESGWPSEGGAG-ASIDNAGTYYANLIRHASSGDGTPKRPGESIETYLFGRCLSENQK 238          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E1310_ARATH (Glucan endo-1,3-beta-glucosidase 10 OS=Arabidopsis thaliana GN=At5g42100 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.161e-17
Identity = 52/133 (39.10%), Postives = 76/133 (57.14%), Query Frame = 3
Query:    3 HISLDYALFQSKDPVVRDGPYLYY-NLFDAMVDAFHSALEKIDVP--NVTLAISESGWPSAGN--EPYTSIENAQKYNKNLMDHVLGGK-GTPRRPGQTFDTFLFEMFNENQKPAGV-EQNFGFFYPNMQPIY 380
            H+SLD+ LFQ        G   +Y N+  A VDA + AL+ + +    V + +SE+GWPS G+  E   + +NA+KYN NL+  ++  K  TP RP      F+F +FNEN KP    E+N+G F P+  P+Y
Sbjct:  212 HVSLDFVLFQPNQGFTDPGSNFHYDNMLFAQVDAVYHALDAVGISYKKVPIVVSETGWPSNGDPQEVGATCDNARKYNGNLIKMMMSKKMRTPIRPECDLTIFVFALFNENMKPGPTSERNYGLFNPDGTPVY 344          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E1311_ARATH (Glucan endo-1,3-beta-glucosidase 11 OS=Arabidopsis thaliana GN=At1g32860 PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 8.318e-16
Identity = 48/131 (36.64%), Postives = 73/131 (55.73%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYY-NLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAG--NEPYTSIENAQKYNKNLMDHVLGGK--GTPRRPGQTFDTFLFEMFNENQKPAGV-EQNFGFFYPNMQPIY 380
            + LD+ LFQ    +V      +Y N+  A +DA +SAL      ++ + ISE+GWPS G  +E   + ENA++YN NL+  ++ GK   TP +P      ++F +FNEN KP    E+N+G F P+    Y
Sbjct:  215 VPLDFVLFQPNQGIVDPATGFHYDNMLFAQIDAVYSALAAAGFKSLRVEISETGWPSKGDDDEVGATPENAKRYNGNLIKMMMSGKKTKTPLKPNNDLSIYVFALFNENLKPGPTSERNYGLFKPDGTQAY 345          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E135_ARATH (Glucan endo-1,3-beta-glucosidase 5 OS=Arabidopsis thaliana GN=At4g31140 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 7.785e-14
Identity = 41/126 (32.54%), Postives = 69/126 (54.76%), Query Frame = 3
Query:   12 LDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQK---PAGVEQNFGFFYPNMQPIY 380
            +++A F      + D   +Y N+ DA  D    +L+K    N+T+ + E GWP+ G++   ++  A++YN+  M+     KGTP RPG   D +LF + +E+ K   P   E+++G FY + QP Y
Sbjct:  219 VEFAFFDGTGTPINDNGRIYDNVLDANYDTLVWSLQKNGFGNLTIIVGEVGWPTDGDK-NANLMYARRYNQGFMNRQKANKGTPMRPG-AMDAYLFGLIDEDAKSIQPGNFERHWGIFYIDGQPKY 342          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13B_BRACM (Glucan endo-1,3-beta-glucosidase OS=Brassica campestris GN=BGL PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 3.616e-11
Identity = 45/134 (33.58%), Postives = 71/134 (52.99%), Query Frame = 3
Query:    6 ISLDYALFQSK------DPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAG----VEQNFGFFYPNMQPI 377
            +SL +AL Q        DP   +    Y N FDA +D+ ++ALEK    ++ + +SESGWP+ G  P  S+ NA+ Y  NL  HV    G+P+R  +  +T++F MF+E  +        E+ +G F P  + +
Sbjct:  208 VSLQFALLQPNSNNEFTDP---NNQLRYLNFFDANLDSVYAALEKSGGGSLDVVVSESGWPTQGG-PGASVPNAEAYVNNLRLHV-NKNGSPKRQ-EAIETYIFAMFDEAPRQTSPNDEYEKYWGMFSPTTRQL 335          
The following BLAST results are available for this feature:
BLAST of DC899993 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 49
Match NameE-valueIdentityDescription
EA6_ARATH2.115e-1942.31Probable glucan endo-1,3-beta-glucosidase A6 OS=Ar... [more]
E13B_WHEAT3.608e-1935.16Glucan endo-1,3-beta-glucosidase OS=Triticum aesti... [more]
E136_ARATH1.371e-1839.68Glucan endo-1,3-beta-glucosidase 6 OS=Arabidopsis ... [more]
E137_ARATH2.339e-1842.06Glucan endo-1,3-beta-glucosidase 7 OS=Arabidopsis ... [more]
E13B_SOYBN1.161e-1744.86Glucan endo-1,3-beta-glucosidase (Fragment) OS=Gly... [more]
E1310_ARATH1.161e-1739.10Glucan endo-1,3-beta-glucosidase 10 OS=Arabidopsis... [more]
E1311_ARATH8.318e-1636.64Glucan endo-1,3-beta-glucosidase 11 OS=Arabidopsis... [more]
E135_ARATH7.785e-1432.54Glucan endo-1,3-beta-glucosidase 5 OS=Arabidopsis ... [more]
E13B_BRACM3.616e-1133.58Glucan endo-1,3-beta-glucosidase OS=Brassica campe... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899993 VSS Citrus sinensis cDNA clone VS27Q04 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899993 ID=DC899993|Name=DC899993|organism=Citrus sinensis|type=EST|length=528bp
CTCACATATCCTTAGACTATGCCTTATTTCAGTCGAAAGATCCTGTAGTT
AGAGACGGGCCATACTTGTATTATAATCTATTTGATGCCATGGTTGATGC
TTTTCACTCAGCTCTGGAGAAGATTGATGTACCGAATGTGACTTTGGCCA
TATCAGAGTCAGGATGGCCTAGTGCTGGCAATGAGCCTTATACAAGCATA
GAAAATGCACAAAAATATAATAAGAACTTGATGGATCATGTCTTGGGAGG
AAAAGGGACTCCGAGGAGGCCAGGTCAAACTTTTGATACATTTTTATTTG
AGATGTTCAATGAGAATCAAAAGCCTGCTGGGGTTGAGCAGAATTTCGGA
TTCTTCTATCCAAATATGCAGCCAATTTATCCATTTTGGCCATGCTAGAA
GCATTTATCTTTTACTTATACTGCTGTAATGTAAGCGTGGTGCCTAATTT
GAAAAAGTAACTTATGAAGCAAGTTACACCTTTGCTTTTGCTAAGTAATA
AAAGAATAGATAGTANTTAATTAAAAAA
back to top