CN185671

Overview
NameCN185671
Unique NameCN185671
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length838
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2850 contig Csv1_Contig2850:53..890. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A_SPOFR (Eukaryotic translation initiation factor 5A OS=Spodoptera frugiperda GN=eIF-5A PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 4.024e-48
Identity = 89/151 (58.94%), Postives = 122/151 (80.79%), Query Frame = -2
Query:  316 EEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALK 768
            E+ HFE+  D+GAS TFP Q   +RKNG++++KGRPCK+VE+STSKTGKHGHAK H VGIDIFNGKK EDI PS+HN DVPHV R DYQL DIS+DG+++L+ +NG+ ++DL++P D +L +Q++  F+SGK+L+ +V  + GEE + A+K
Sbjct:    5 EDTHFET-GDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFNGKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIP-DGDLGTQLRSDFDSGKELLCTVLKSCGEECVIAVK 153          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A_SPOEX (Eukaryotic translation initiation factor 5A OS=Spodoptera exigua GN=eIF-5A PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 4.024e-48
Identity = 89/151 (58.94%), Postives = 122/151 (80.79%), Query Frame = -2
Query:  316 EEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALK 768
            E+ HFE+  D+GAS TFP Q   +RKNG++++KGRPCK+VE+STSKTGKHGHAK H VGIDIFNGKK EDI PS+HN DVPHV R DYQL DIS+DG+++L+ +NG+ ++DL++P D +L +Q++  F+SGK+L+ +V  + GEE + A+K
Sbjct:    5 EDTHFET-GDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFNGKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIP-DGDLGTQLRSDFDSGKELLCTVLKSCGEECVIAVK 153          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A2_SCHPO (Eukaryotic translation initiation factor 5A-2 OS=Schizosaccharomyces pombe GN=tif51b PE=2 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 1.295e-46
Identity = 90/155 (58.06%), Postives = 121/155 (78.06%), Query Frame = -2
Query:  313 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKD 777
            M++EEH      +AGAS TFP Q   +RKNG++VIKGRPCK+V++STSKTGKHGHAK H V +DIFNG+K ED+ PS+HN DVP V R +YQL++I +DG+++L+T +G TKDD+RLP  E L ++I++GFE GKDL+++V  AMGEE   A +D
Sbjct:    1 MAEEEHVDFEGGEAGASLTFPMQCSALRKNGHVVIKGRPCKIVDMSTSKTGKHGHAKVHIVALDIFNGRKYEDMSPSTHNMDVPVVKRDEYQLVNI-DDGYLNLMTTDGTTKDDVRLPEGE-LGNEIEEGFEEGKDLIITVVSAMGEEIALACRD 153          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A1_YEAST (Eukaryotic translation initiation factor 5A-1 OS=Saccharomyces cerevisiae GN=HYP1 PE=1 SV=3)

HSP 1 Score: 186.422 bits (472), Expect = 1.691e-46
Identity = 91/155 (58.71%), Postives = 121/155 (78.06%), Query Frame = -2
Query:  313 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKD 777
            MSDEEH FE+ ADAGAS T+P Q   +RKNG++VIKGRPCK+V++STSKTGKHGHAK H V +DIF GKKLED+ PS+HN +VP V R++YQL+DI +DG++SL+T +G TKDD++ P  E L   ++  F+ GKDL+V++  AMGEE   + K+
Sbjct:    1 MSDEEHTFEN-ADAGASATYPMQCSALRKNGFVVIKGRPCKIVDMSTSKTGKHGHAKVHLVTLDIFTGKKLEDLSPSTHNLEVPFVKRSEYQLLDI-DDGYLSLMTMDGETKDDVKAPEGE-LGDSMQAAFDEGKDLMVTIISAMGEEAAISFKE 152          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A1_SCHPO (Eukaryotic translation initiation factor 5A-1 OS=Schizosaccharomyces pombe GN=tif51a PE=1 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 3.767e-46
Identity = 88/155 (56.77%), Postives = 121/155 (78.06%), Query Frame = -2
Query:  313 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKD 777
            M++EEH      +AGAS TFP Q   +RKNG++VIKGRPCK+V++STSKTGKHGHAK H V +DIFNG+K ED+ PS+HN DVP V R +YQL++I +DG+++L+T +G TKDD+RLP  E L ++I++GF+ G+DL+++V  AMGEE   A +D
Sbjct:    1 MAEEEHVDFEGGEAGASLTFPMQCSALRKNGHVVIKGRPCKIVDMSTSKTGKHGHAKVHIVALDIFNGRKYEDMSPSTHNMDVPVVKRDEYQLVNI-DDGYLNLMTTDGTTKDDVRLPEGE-LGNEIEEGFDEGRDLIITVVSAMGEETALACRD 153          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A2_YEAST (Eukaryotic translation initiation factor 5A-2 OS=Saccharomyces cerevisiae GN=HYP2 PE=1 SV=3)

HSP 1 Score: 183.726 bits (465), Expect = 1.096e-45
Identity = 90/155 (58.06%), Postives = 119/155 (76.77%), Query Frame = -2
Query:  313 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKD 777
            MSDEEH FE+ ADAG+S T+P Q   +RKNG++VIK RPCK+V++STSKTGKHGHAK H V IDIF GKKLED+ PS+HN +VP V R +YQL+DI +DGF+SL+  +G+TKDD++ P  E L   ++  F+ GKDL+V++  AMGEE   + K+
Sbjct:    1 MSDEEHTFET-ADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDI-DDGFLSLMNMDGDTKDDVKAPEGE-LGDSLQTAFDEGKDLMVTIISAMGEEAAISFKE 152          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A2_PONAB (Eukaryotic translation initiation factor 5A-2 OS=Pongo abelii GN=EIF5A2 PE=2 SV=3)

HSP 1 Score: 180.259 bits (456), Expect = 1.212e-44
Identity = 87/142 (61.27%), Postives = 110/142 (77.46%), Query Frame = -2
Query:  316 DAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALK 741
            DAGAS T+P Q   +RKNG++V+KGRPCK+VE+STSKTGKHGHAK H VGIDIF GKK EDI PS+HN DVP++ R DYQLI I +DG++SLLTE G  ++DL+LP  E L  +I+  + +G+D+ VSV CAM EE   A+K
Sbjct:   11 DAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICI-QDGYLSLLTETGEVREDLKLPEGE-LGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIK 150          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A2_MOUSE (Eukaryotic translation initiation factor 5A-2 OS=Mus musculus GN=Eif5a2 PE=2 SV=3)

HSP 1 Score: 180.259 bits (456), Expect = 1.212e-44
Identity = 87/142 (61.27%), Postives = 110/142 (77.46%), Query Frame = -2
Query:  316 DAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALK 741
            DAGAS T+P Q   +RKNG++V+KGRPCK+VE+STSKTGKHGHAK H VGIDIF GKK EDI PS+HN DVP++ R DYQLI I +DG++SLLTE G  ++DL+LP  E L  +I+  + +G+D+ VSV CAM EE   A+K
Sbjct:   11 DAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICI-QDGYLSLLTETGEVREDLKLPEGE-LGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIK 150          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A2_HUMAN (Eukaryotic translation initiation factor 5A-2 OS=Homo sapiens GN=EIF5A2 PE=1 SV=3)

HSP 1 Score: 180.259 bits (456), Expect = 1.212e-44
Identity = 87/142 (61.27%), Postives = 110/142 (77.46%), Query Frame = -2
Query:  316 DAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALK 741
            DAGAS T+P Q   +RKNG++V+KGRPCK+VE+STSKTGKHGHAK H VGIDIF GKK EDI PS+HN DVP++ R DYQLI I +DG++SLLTE G  ++DL+LP  E L  +I+  + +G+D+ VSV CAM EE   A+K
Sbjct:   11 DAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICI-QDGYLSLLTETGEVREDLKLPEGE-LGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIK 150          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A_CANAL (Eukaryotic translation initiation factor 5A OS=Candida albicans GN=ANB1 PE=3 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 7.854e-44
Identity = 86/152 (56.58%), Postives = 120/152 (78.95%), Query Frame = -2
Query:  313 EEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKD 768
            EE  FE+ ADAGA+ TFP Q   +RKNG++VIK RPCK+V++STSKTGKHGHAK H V IDIF GKKLED+ PS+HN +VP+V+R ++QL+DI +DG++SL+T +G+TKDD+++P  E L  +++  F+ GKDL+V++  AMGEE   + K+
Sbjct:    3 EEDTFET-ADAGAALTFPMQCSALRKNGHVVIKNRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPNVSRQEFQLLDI-DDGYLSLMTADGDTKDDVKVPEGE-LGDKLQSEFDEGKDLIVTIISAMGEEAAISYKE 151          
The following BLAST results are available for this feature:
BLAST of CN185671 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 64
Match NameE-valueIdentityDescription
IF5A_SPOFR4.024e-4858.94Eukaryotic translation initiation factor 5A OS=Spo... [more]
IF5A_SPOEX4.024e-4858.94Eukaryotic translation initiation factor 5A OS=Spo... [more]
IF5A2_SCHPO1.295e-4658.06Eukaryotic translation initiation factor 5A-2 OS=S... [more]
IF5A1_YEAST1.691e-4658.71Eukaryotic translation initiation factor 5A-1 OS=S... [more]
IF5A1_SCHPO3.767e-4656.77Eukaryotic translation initiation factor 5A-1 OS=S... [more]
IF5A2_YEAST1.096e-4558.06Eukaryotic translation initiation factor 5A-2 OS=S... [more]
IF5A2_PONAB1.212e-4461.27Eukaryotic translation initiation factor 5A-2 OS=P... [more]
IF5A2_MOUSE1.212e-4461.27Eukaryotic translation initiation factor 5A-2 OS=M... [more]
IF5A2_HUMAN1.212e-4461.27Eukaryotic translation initiation factor 5A-2 OS=H... [more]
IF5A_CANAL7.854e-4456.58Eukaryotic translation initiation factor 5A OS=Can... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001L05_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001L05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185671 ID=CN185671|Name=CN185671|organism=Citrus sinensis|type=EST|length=838bp
TTTTTTTTTCCCGAAGCTGTAAATTGCATGTTTGAAACAACCAAAAGGTG
CTTCCATGTGTATATACAGTCACGTTGGCGGATACAACTTCTGCACACCG
AGAACAACCATGTTTCAACTTTCAAGCAATCAAACAGAATAAAAATACTG
TCGATAGAAAACAATTAATAATATGGTAAGAGTCATTTTATATGAAATGA
TGGCATTCATCTTGAAACCGGACACCAGTAAAGCTACACTACTATCCACC
TTCCCACAGCTTTCAGCAATCTGCATTCTCGATCAAGCAAAAGTCTTTTA
CTTGGGGCCAATGTCCTTCAGGGCATTGATCTGCTCCTCTCCCATAGCAC
ACTGAACTGAGACAACCAGATCTTTCCCACTCTCAAATCCATCCTTGATC
TGTGAAAGCAGATTTTCATCAGTTGGAAGTCTCAGGTCATCCTTGGTATT
GCCATTCTCAGTCAGCAGGCTAACAAATCCATCCTCAGAGATATCAATCA
GCTGGTAGTCAGTGCGAGTGACATGAGGAACATCACAGTTGTGGGAAGAG
GGAACAATATCCTCAAGCTTCTTGCCATTGAAGATGTCAATTCCTACAAA
GTGACACTTAGCATGACCGTGCTTTCCAGTCTTGGAAGTTGAAACCTCAA
CAACCTTGCAAGGACGACCTTTGATGACGATATAACCGTTTTTGCGGATG
GTTCCGGCCTGCTGAGGAAATGTCTTGGAGGCGCCGGCGTCGGCCTTCGA
CTCAAAGTGGTGCTCTTCGTCCGACATATCGTCTGGTTCCTGCGATTCAC
AATTAGAGCTTCGACAACCAAATTTTGGTAGAATCGAA
back to top