CN185671

Overview
NameCN185671
Unique NameCN185671
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length838
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2850 contig Csv1_Contig2850:53..890. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A_CALMQ (Translation initiation factor 5A OS=Caldivirga maquilingensis (strain DSMZ 13496 / IC-167) GN=eIF5A PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.035e-11
Identity = 35/76 (46.05%), Postives = 47/76 (61.84%), Query Frame = -2
Query:  481 AGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISED 708
            AG I++  YI+I   PC+VVEV  SKTGKHG AK   VGI + +G K   +VP+    +VP + +   Q+I IS D
Sbjct:    8 AGDIKEGSYIMIDNMPCRVVEVEKSKTGKHGSAKARIVGIGVIDGVKRTIVVPTDAAVEVPVIEKFTAQVISISGD 83          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A_KORCO (Translation initiation factor 5A OS=Korarchaeum cryptofilum (strain OPF8) GN=eIF5A PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.352e-11
Identity = 39/109 (35.78%), Postives = 58/109 (53.21%), Query Frame = -2
Query:  382 AGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFE 708
            AG +RK  Y+++   PC+V+EVS SK GKHG AK       IF+G +   I P+    ++P V +   Q+I++     V L+        +L LP D  L S++K G E
Sbjct:    8 AGDLRKGSYVILDDEPCEVLEVSKSKPGKHGSAKVRVEARGIFDGARRSKIFPADALVEIPIVDKKTAQVINV-YGNVVQLMDLETYETFELPLPEDPELASRLKSGIE 115          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A_HYPBU (Translation initiation factor 5A OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403) GN=eIF5A PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.352e-11
Identity = 38/108 (35.19%), Postives = 59/108 (54.63%), Query Frame = -2
Query:  382 GTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFE 705
            G ++   YIVI G PC++VE+S +KTGKHG AK H V + +F+G K     P     +VP + +   Q+I    D  V ++        ++  P DE+L S+++ G E
Sbjct:    9 GELKVGSYIVIDGEPCRIVEMSKAKTGKHGSAKAHVVAVCLFSGNKKTLTAPVDARVEVPIIDKRIGQVIADMGD-MVQIMDMETYETFEVEKPKDEDLKSKLQPGVE 115          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A_SULIL (Translation initiation factor 5A OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=eIF5A PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.766e-11
Identity = 38/108 (35.19%), Postives = 60/108 (55.56%), Query Frame = -2
Query:  382 GTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFE 705
            G ++   Y+VI G PC+VVEV+ +KTGKHG AK + V I +F+G K   + P     +VP + +   Q+I   +D    +  E   T  ++  PT++ L S+I+   E
Sbjct:    9 GELKVGSYVVIDGEPCRVVEVTKAKTGKHGSAKANVVAIGVFSGAKKTLMAPVDQQVEVPIIEKHIGQIIADMDDKIQVMDLETYET-FEIEKPTEDELASKIRPNAE 115          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A_METKA (Translation initiation factor 5A OS=Methanopyrus kandleri GN=eif5a PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.766e-11
Identity = 43/129 (33.33%), Postives = 65/129 (50.39%), Query Frame = -2
Query:  313 IRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKD 699
            ++K  YI+I   PCK+VE +TS  GKHG AK   V + +F+GKK     P     DVP + R   Q++    D  V L+        +++ P DE L SQ++ G       +V    A G+ +I  +K+
Sbjct:   13 LKKGKYIMIDDEPCKIVEYTTSSPGKHGSAKARIVAVGLFDGKKRTLTKPVDAKVDVPVIERKTAQVVSDMGD-TVQLMDMETYETFEVQKPEDEELASQLEPG------TMVEYMEAAGKRKIVGIKE 134          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A_THENV (Translation initiation factor 5A OS=Thermoproteus neutrophilus (strain DSM 2338 / JCM 9278 / V24Sta) GN=eIF5A PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 3.934e-11
Identity = 31/77 (40.26%), Postives = 47/77 (61.04%), Query Frame = -2
Query:  481 QAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISED 711
            +AG +++  Y+VI G PC+VVE+  SKTGKHG AK   V + +F+G K    +P     +VP + +   Q++ IS D
Sbjct:    7 EAGELKEGSYVVIDGEPCRVVEIEKSKTGKHGSAKARIVAVGVFDGGKRTLSLPVDAQVEVPIIEKFTAQVLSISGD 83          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A_PYRAE (Translation initiation factor 5A OS=Pyrobaculum aerophilum GN=eif5a PE=1 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 3.934e-11
Identity = 30/77 (38.96%), Postives = 47/77 (61.04%), Query Frame = -2
Query:  481 QAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISED 711
            +AG +++  Y+VI G PC+VVE+  SKTGKHG AK   V + +F+G K    +P     +VP + +   Q++ +S D
Sbjct:   13 EAGELKEGSYVVIDGEPCRVVEIEKSKTGKHGSAKARIVAVGVFDGGKRTLSLPVDAQVEVPIIEKFTAQILSVSGD 89          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A_SULIY (Translation initiation factor 5A OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=eIF5A PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.138e-11
Identity = 38/108 (35.19%), Postives = 59/108 (54.63%), Query Frame = -2
Query:  382 GTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFE 705
            G ++   Y+VI G PC+VVEV+ +KTGKHG AK + V I +F+G K   + P     +VP + +   Q+I    D    +  E   T  ++  PT++ L S+I+   E
Sbjct:    9 GELKVGSYVVIDGEPCRVVEVTKAKTGKHGSAKANVVAIGVFSGAKKTLMAPVDQQVEVPIIEKHIGQIIADMGDKIQVMDLETYET-FEIEKPTEDELASKIRPNAE 115          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A_SULIN (Translation initiation factor 5A OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=eIF5A PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.138e-11
Identity = 38/108 (35.19%), Postives = 59/108 (54.63%), Query Frame = -2
Query:  382 GTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFE 705
            G ++   Y+VI G PC+VVEV+ +KTGKHG AK + V I +F+G K   + P     +VP + +   Q+I    D    +  E   T  ++  PT++ L S+I+   E
Sbjct:    9 GELKVGSYVVIDGEPCRVVEVTKAKTGKHGSAKANVVAIGVFSGAKKTLMAPVDQQVEVPIIEKHIGQIIADMGDKIQVMDLETYET-FEIEKPTEDELASKIRPNAE 115          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A_SULIM (Translation initiation factor 5A OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=eIF5A PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.138e-11
Identity = 38/108 (35.19%), Postives = 59/108 (54.63%), Query Frame = -2
Query:  382 GTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFE 705
            G ++   Y+VI G PC+VVEV+ +KTGKHG AK + V I +F+G K   + P     +VP + +   Q+I    D    +  E   T  ++  PT++ L S+I+   E
Sbjct:    9 GELKVGSYVVIDGEPCRVVEVTKAKTGKHGSAKANVVAIGVFSGAKKTLMAPVDQQVEVPIIEKHIGQIIADMGDKIQVMDLETYET-FEIEKPTEDELASKIRPNAE 115          
The following BLAST results are available for this feature:
BLAST of CN185671 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 64
Match NameE-valueIdentityDescription
IF5A_CALMQ1.035e-1146.05Translation initiation factor 5A OS=Caldivirga maq... [more]
IF5A_KORCO1.352e-1135.78Translation initiation factor 5A OS=Korarchaeum cr... [more]
IF5A_HYPBU1.352e-1135.19Translation initiation factor 5A OS=Hyperthermus b... [more]
IF5A_SULIL1.766e-1135.19Translation initiation factor 5A OS=Sulfolobus isl... [more]
IF5A_METKA1.766e-1133.33Translation initiation factor 5A OS=Methanopyrus k... [more]
IF5A_THENV3.934e-1140.26Translation initiation factor 5A OS=Thermoproteus ... [more]
IF5A_PYRAE3.934e-1138.96Translation initiation factor 5A OS=Pyrobaculum ae... [more]
IF5A_SULIY5.138e-1135.19Translation initiation factor 5A OS=Sulfolobus isl... [more]
IF5A_SULIN5.138e-1135.19Translation initiation factor 5A OS=Sulfolobus isl... [more]
IF5A_SULIM5.138e-1135.19Translation initiation factor 5A OS=Sulfolobus isl... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001L05_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001L05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185671 ID=CN185671|Name=CN185671|organism=Citrus sinensis|type=EST|length=838bp
TTTTTTTTTCCCGAAGCTGTAAATTGCATGTTTGAAACAACCAAAAGGTG
CTTCCATGTGTATATACAGTCACGTTGGCGGATACAACTTCTGCACACCG
AGAACAACCATGTTTCAACTTTCAAGCAATCAAACAGAATAAAAATACTG
TCGATAGAAAACAATTAATAATATGGTAAGAGTCATTTTATATGAAATGA
TGGCATTCATCTTGAAACCGGACACCAGTAAAGCTACACTACTATCCACC
TTCCCACAGCTTTCAGCAATCTGCATTCTCGATCAAGCAAAAGTCTTTTA
CTTGGGGCCAATGTCCTTCAGGGCATTGATCTGCTCCTCTCCCATAGCAC
ACTGAACTGAGACAACCAGATCTTTCCCACTCTCAAATCCATCCTTGATC
TGTGAAAGCAGATTTTCATCAGTTGGAAGTCTCAGGTCATCCTTGGTATT
GCCATTCTCAGTCAGCAGGCTAACAAATCCATCCTCAGAGATATCAATCA
GCTGGTAGTCAGTGCGAGTGACATGAGGAACATCACAGTTGTGGGAAGAG
GGAACAATATCCTCAAGCTTCTTGCCATTGAAGATGTCAATTCCTACAAA
GTGACACTTAGCATGACCGTGCTTTCCAGTCTTGGAAGTTGAAACCTCAA
CAACCTTGCAAGGACGACCTTTGATGACGATATAACCGTTTTTGCGGATG
GTTCCGGCCTGCTGAGGAAATGTCTTGGAGGCGCCGGCGTCGGCCTTCGA
CTCAAAGTGGTGCTCTTCGTCCGACATATCGTCTGGTTCCTGCGATTCAC
AATTAGAGCTTCGACAACCAAATTTTGGTAGAATCGAA
back to top