CN185551

Overview
NameCN185551
Unique NameCN185551
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length366
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig421 contig Csv1_Contig421:22..387. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185551 vs. ExPASy Swiss-Prot
Match: H2AY_MOUSE (Core histone macro-H2A.1 OS=Mus musculus GN=H2afy PE=1 SV=3)

HSP 1 Score: 68.5514 bits (166), Expect = 1.147e-11
Identity = 36/64 (56.25%), Postives = 48/64 (75.00%), Query Frame = 1
Query:  175 SRSSRAGLQFPVGRIHRLLKSRTTAHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRI 366
            SRS++AG+ FPVGR+ R +K     + R+G  A VY AA+LEYLTAE+LELAGNA++D K  R+
Sbjct:   14 SRSAKAGVIFPVGRMLRYIKKGHPKY-RIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRV 76          
BLAST of CN185551 vs. ExPASy Swiss-Prot
Match: H2AY_HUMAN (Core histone macro-H2A.1 OS=Homo sapiens GN=H2AFY PE=1 SV=4)

HSP 1 Score: 68.5514 bits (166), Expect = 1.147e-11
Identity = 36/64 (56.25%), Postives = 48/64 (75.00%), Query Frame = 1
Query:  175 SRSSRAGLQFPVGRIHRLLKSRTTAHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRI 366
            SRS++AG+ FPVGR+ R +K     + R+G  A VY AA+LEYLTAE+LELAGNA++D K  R+
Sbjct:   14 SRSAKAGVIFPVGRMLRYIKKGHPKY-RIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRV 76          
BLAST of CN185551 vs. ExPASy Swiss-Prot
Match: H2AY_CHICK (Core histone macro-H2A.1 OS=Gallus gallus GN=H2AFY PE=1 SV=3)

HSP 1 Score: 68.5514 bits (166), Expect = 1.147e-11
Identity = 36/64 (56.25%), Postives = 48/64 (75.00%), Query Frame = 1
Query:  175 SRSSRAGLQFPVGRIHRLLKSRTTAHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRI 366
            SRS++AG+ FPVGR+ R +K     + R+G  A VY AA+LEYLTAE+LELAGNA++D K  R+
Sbjct:   14 SRSAKAGVIFPVGRMLRYIKKGHPKY-RIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRV 76          
The following BLAST results are available for this feature:
BLAST of CN185551 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 233
Match NameE-valueIdentityDescription
H2AY_MOUSE1.147e-1156.25Core histone macro-H2A.1 OS=Mus musculus GN=H2afy ... [more]
H2AY_HUMAN1.147e-1156.25Core histone macro-H2A.1 OS=Homo sapiens GN=H2AFY ... [more]
H2AY_CHICK1.147e-1156.25Core histone macro-H2A.1 OS=Gallus gallus GN=H2AFY... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001I06_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001I06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185551 ID=CN185551; Name=CN185551; organism=Citrus sinensis; type=EST; length=366bp
GAGGGTTCTTTGGCTTTGAAACCTCACCCGTCTTTCTTCATCTTTGCGGA
ATCTGTCTCTGTCTCGAAATCTGTTAAATTATTGGCGGGAAAGATGTCGG
GAAAAGGCGCGAAAGGTTTGATCATGGGAAAGGCCTCGGCTAGTAACAAG
GACAAGGACAAGAAGAAACCCATTTCCCGCTCTTCCCGTGCTGGCCTTCA
GTTCCCGGTTGGTCGGATTCACCGTCTTTTGAAGTCAAGAACCACAGCAC
ATGGAAGAGTAGGAGCGACTGCTGCTGTGTACTCTGCTGCCATCTTGGAA
TATTTGACTGCAGAGGTGTTGGAGCTGGCTGGAAATGCAAGCAAAGATCT
TAAGGTGAAGCGTATA
back to top