CN185551

Overview
NameCN185551
Unique NameCN185551
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length366
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig421 contig Csv1_Contig421:22..387. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185551 vs. ExPASy Swiss-Prot
Match: H2AZ_PHANO (Histone H2A.Z OS=Phaeosphaeria nodorum GN=HTZ1 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.185e-16
Identity = 43/64 (67.19%), Postives = 52/64 (81.25%), Query Frame = 1
Query:  175 SRSSRAGLQFPVGRIHRLLKSRTTAHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRI 366
            S S++AGLQFP GRI R L++ T    R+GA A++Y  A+LEYLTAEVLELAGNA+KDLKVKRI
Sbjct:   25 SHSAKAGLQFPCGRIKRHLRTITRQKTRIGAKASIYLTAVLEYLTAEVLELAGNAAKDLKVKRI 88          
BLAST of CN185551 vs. ExPASy Swiss-Prot
Match: H2A_TIGCA (Histone H2A OS=Tigriopus californicus GN=His2A PE=3 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 1.547e-16
Identity = 51/91 (56.04%), Postives = 59/91 (64.84%), Query Frame = 1
Query:   94 MSGKGAKGLIMGXXXXXXXXXXXXXPISRSSRAGLQFPVGRIHRLLKSRTTAHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRI 366
            MSG+G  G + G               SRS+RAGLQFPVGRIHRLL+    A  RVGA A VY AA++EYL AEVLELAGNA++D K  RI
Sbjct:    1 MSGRGKGGKVKGKAK------------SRSNRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRI 78          
BLAST of CN185551 vs. ExPASy Swiss-Prot
Match: H2A_RHYAM (Histone H2A OS=Rhynchosciara americana GN=His2A PE=3 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 1.547e-16
Identity = 51/91 (56.04%), Postives = 59/91 (64.84%), Query Frame = 1
Query:   94 MSGKGAKGLIMGXXXXXXXXXXXXXPISRSSRAGLQFPVGRIHRLLKSRTTAHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRI 366
            MSG+G  G + G               SRS+RAGLQFPVGRIHRLL+    A  RVGA A VY AA++EYL AEVLELAGNA++D K  RI
Sbjct:    1 MSGRGKGGKVKGKAK------------SRSNRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRI 78          
BLAST of CN185551 vs. ExPASy Swiss-Prot
Match: H2A_MYTGA (Histone H2A OS=Mytilus galloprovincialis PE=3 SV=3)

HSP 1 Score: 84.7297 bits (208), Expect = 1.547e-16
Identity = 47/64 (73.44%), Postives = 51/64 (79.69%), Query Frame = 1
Query:  175 SRSSRAGLQFPVGRIHRLLKSRTTAHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRI 366
            SRSSRAGLQFPVGRIHRLL+    A  RVGA A VY AA+LEYL AEVLELAGNA++D K  RI
Sbjct:   16 SRSSRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRI 78          
BLAST of CN185551 vs. ExPASy Swiss-Prot
Match: H2A_MYTED (Histone H2A OS=Mytilus edulis PE=3 SV=3)

HSP 1 Score: 84.7297 bits (208), Expect = 1.547e-16
Identity = 47/64 (73.44%), Postives = 51/64 (79.69%), Query Frame = 1
Query:  175 SRSSRAGLQFPVGRIHRLLKSRTTAHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRI 366
            SRSSRAGLQFPVGRIHRLL+    A  RVGA A VY AA+LEYL AEVLELAGNA++D K  RI
Sbjct:   16 SRSSRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRI 78          
BLAST of CN185551 vs. ExPASy Swiss-Prot
Match: H2A_MYTCH (Histone H2A OS=Mytilus chilensis PE=3 SV=3)

HSP 1 Score: 84.7297 bits (208), Expect = 1.547e-16
Identity = 47/64 (73.44%), Postives = 51/64 (79.69%), Query Frame = 1
Query:  175 SRSSRAGLQFPVGRIHRLLKSRTTAHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRI 366
            SRSSRAGLQFPVGRIHRLL+    A  RVGA A VY AA+LEYL AEVLELAGNA++D K  RI
Sbjct:   16 SRSSRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRI 78          
BLAST of CN185551 vs. ExPASy Swiss-Prot
Match: H2A_MYTCA (Histone H2A OS=Mytilus californianus PE=3 SV=3)

HSP 1 Score: 84.7297 bits (208), Expect = 1.547e-16
Identity = 47/64 (73.44%), Postives = 51/64 (79.69%), Query Frame = 1
Query:  175 SRSSRAGLQFPVGRIHRLLKSRTTAHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRI 366
            SRSSRAGLQFPVGRIHRLL+    A  RVGA A VY AA+LEYL AEVLELAGNA++D K  RI
Sbjct:   16 SRSSRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRI 78          
BLAST of CN185551 vs. ExPASy Swiss-Prot
Match: H2A_DROYA (Histone H2A OS=Drosophila yakuba GN=His2A PE=2 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 1.547e-16
Identity = 51/91 (56.04%), Postives = 59/91 (64.84%), Query Frame = 1
Query:   94 MSGKGAKGLIMGXXXXXXXXXXXXXPISRSSRAGLQFPVGRIHRLLKSRTTAHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRI 366
            MSG+G  G + G               SRS+RAGLQFPVGRIHRLL+    A  RVGA A VY AA++EYL AEVLELAGNA++D K  RI
Sbjct:    1 MSGRGKGGKVKGKAK------------SRSNRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRI 78          
BLAST of CN185551 vs. ExPASy Swiss-Prot
Match: H2A_DROSI (Histone H2A OS=Drosophila simulans GN=His2A PE=3 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 1.547e-16
Identity = 51/91 (56.04%), Postives = 59/91 (64.84%), Query Frame = 1
Query:   94 MSGKGAKGLIMGXXXXXXXXXXXXXPISRSSRAGLQFPVGRIHRLLKSRTTAHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRI 366
            MSG+G  G + G               SRS+RAGLQFPVGRIHRLL+    A  RVGA A VY AA++EYL AEVLELAGNA++D K  RI
Sbjct:    1 MSGRGKGGKVKGKAK------------SRSNRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRI 78          
BLAST of CN185551 vs. ExPASy Swiss-Prot
Match: H2A_DROME (Histone H2A OS=Drosophila melanogaster GN=His2A PE=1 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 1.547e-16
Identity = 51/91 (56.04%), Postives = 59/91 (64.84%), Query Frame = 1
Query:   94 MSGKGAKGLIMGXXXXXXXXXXXXXPISRSSRAGLQFPVGRIHRLLKSRTTAHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRI 366
            MSG+G  G + G               SRS+RAGLQFPVGRIHRLL+    A  RVGA A VY AA++EYL AEVLELAGNA++D K  RI
Sbjct:    1 MSGRGKGGKVKGKAK------------SRSNRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRI 78          
The following BLAST results are available for this feature:
BLAST of CN185551 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 233
Match NameE-valueIdentityDescription
H2AZ_PHANO1.185e-1667.19Histone H2A.Z OS=Phaeosphaeria nodorum GN=HTZ1 PE=... [more]
H2A_TIGCA1.547e-1656.04Histone H2A OS=Tigriopus californicus GN=His2A PE=... [more]
H2A_RHYAM1.547e-1656.04Histone H2A OS=Rhynchosciara americana GN=His2A PE... [more]
H2A_MYTGA1.547e-1673.44Histone H2A OS=Mytilus galloprovincialis PE=3 SV=3[more]
H2A_MYTED1.547e-1673.44Histone H2A OS=Mytilus edulis PE=3 SV=3[more]
H2A_MYTCH1.547e-1673.44Histone H2A OS=Mytilus chilensis PE=3 SV=3[more]
H2A_MYTCA1.547e-1673.44Histone H2A OS=Mytilus californianus PE=3 SV=3[more]
H2A_DROYA1.547e-1656.04Histone H2A OS=Drosophila yakuba GN=His2A PE=2 SV=... [more]
H2A_DROSI1.547e-1656.04Histone H2A OS=Drosophila simulans GN=His2A PE=3 S... [more]
H2A_DROME1.547e-1656.04Histone H2A OS=Drosophila melanogaster GN=His2A PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001I06_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001I06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185551 ID=CN185551; Name=CN185551; organism=Citrus sinensis; type=EST; length=366bp
GAGGGTTCTTTGGCTTTGAAACCTCACCCGTCTTTCTTCATCTTTGCGGA
ATCTGTCTCTGTCTCGAAATCTGTTAAATTATTGGCGGGAAAGATGTCGG
GAAAAGGCGCGAAAGGTTTGATCATGGGAAAGGCCTCGGCTAGTAACAAG
GACAAGGACAAGAAGAAACCCATTTCCCGCTCTTCCCGTGCTGGCCTTCA
GTTCCCGGTTGGTCGGATTCACCGTCTTTTGAAGTCAAGAACCACAGCAC
ATGGAAGAGTAGGAGCGACTGCTGCTGTGTACTCTGCTGCCATCTTGGAA
TATTTGACTGCAGAGGTGTTGGAGCTGGCTGGAAATGCAAGCAAAGATCT
TAAGGTGAAGCGTATA
back to top