CN185528

Overview
NameCN185528
Unique NameCN185528
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length625
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9471 contig Csv1_Contig9471:189..813. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: GAR2_SCHPO (Protein gar2 OS=Schizosaccharomyces pombe GN=gar2 PE=1 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 2.332e-11
Identity = 49/186 (26.34%), Postives = 89/186 (47.85%), Query Frame = 2
Query:   95 PDASSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLN---------WATYGAGE-RRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRI 622
            P   S+   ++++G L   +++ ++   F   G  V  +VI + Q+  S+GYG+++F +  AA+  +      ++     N  L+         +A   AG    Q   P  T+FVG+L+ + T+  L   F      ++  ++ TD  +GR KG+G+V F D  +  +   EMNG   + RP R+
Sbjct:  255 PSQDSNETCTVFVGRLSWNVDDQWLGQEFEEYGTIVGARVIMDGQSGRSKGYGYVDFETPEAAKAAVAANGTKEIDGRMVNLDLSNPRPANPQPYAQQRAGNFGDQLSEPSDTVFVGNLSFNATEDDLSTAFGGC-GDIQSIRLPTDPQSGRLKGFGYVTFSD-IDSAKKCVEMNGHFIAGRPCRL 438          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: ELAV3_XENTR (ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl3 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.332e-11
Identity = 44/165 (26.67%), Postives = 84/165 (50.91%), Query Frame = 2
Query:  101 ASSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGR-SKGYGFVRFGDESEQLRSMTEMNG 592
            A+ D   +L +  L   M +    S+FG  GE  S K++R+K T  S GYGF+ +V    A++ + T NG ++ +  +  ++++A   +   R     D  ++V  L   +    +++ F + Y  +  ++++ D+ TG  S+G GF+RF    E   ++  +NG
Sbjct:   29 AADDSKTNLIVNYLPQNMTQEEFKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYVDPNDADKAINTLNGLKLQT--KTIKVSYARPSSASIR-----DANLYVSSLPKTMNQKEMEQLF-SQYGRIITSRILVDQVTGSVSRGVGFIRFDKRIEAEEAIKGLNG 185          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: ELAV3_MOUSE (ELAV-like protein 3 OS=Mus musculus GN=Elavl3 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.332e-11
Identity = 42/164 (25.61%), Postives = 84/164 (51.22%), Query Frame = 2
Query:  101 ASSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNG 592
            A+ D   +L +  L   M +    S+FG  G+  S K++R+K T  S GYGF+ +     A++ + T NG ++ +  +  ++++A   +   R     D  ++V  L   ++   +++ F + Y  +  ++++ D+ TG S+G GF+RF    E   ++  +NG
Sbjct:   33 ATDDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQT--KTIKVSYARPSSASIR-----DANLYVSGLPKTMSQKEMEQLF-SQYGRIITSRILLDQATGVSRGVGFIRFDKRIEAEEAIKGLNG 188          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: ELAV1_XENTR (ELAV-like protein 1 OS=Xenopus tropicalis GN=elavl1 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.332e-11
Identity = 42/160 (26.25%), Postives = 74/160 (46.25%), Query Frame = 2
Query:  113 GIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNG 592
            G  +L +  L   M +  + S+F   GE  S K+IR+K    S GYGF+ +++   AER + T NG ++ S                   +   D  +++  L   +T   +++ F   +  +  ++V+ D+ TG S+G  F+RF   SE   ++   NG
Sbjct:   18 GRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYLNAKDAERAINTLNGLRLQS-------KTIKVSVARPSSESIKDANLYISGLPRTMTQKDVEDMF-LPFGRIINSRVLVDQATGLSRGVAFIRFDKRSEAEEAIASFNG 169          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: ROC5_NICSY (33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.978e-11
Identity = 46/179 (25.70%), Postives = 88/179 (49.16%), Query Frame = 2
Query:  125 LWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQD-------------DGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRI 622
            L++G+L   M  S ++ IF   G   + +++ ++ T+ S G+ F+   S   A+  ++ F+G+Q+    +  ++N+     G  R+              D P   ++V +L+  +T   L++ F A       AKV+ DR++GRS+G+GF+ F        ++  MN V    RP+R+
Sbjct:  116 LYVGNLPFSMTSSQLSEIFAEAGTVANVEIVYDRVTDRSRGFAFVTMGSVEEAKEAIRLFDGSQVGG--RTVKVNFPEVPRGGEREVMSAKIRSTYQGFVDSPH-KLYVANLSWALTSQGLRDAF-ADQPGFMSAKVIYDRSSGRSRGFGFITFSSAEAMNSALDTMNEVELEGRPLRL 290          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: ROC2_NICPL (31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.785e-11
Identity = 52/196 (26.53%), Postives = 90/196 (45.92%), Query Frame = 2
Query:  125 LWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQM------------PSTEQNFRLNW-----ATYGAGERRQDDGPDF-------------TIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRI 622
            L++G+L   ++ + +A +F   G     +VI +K +  S G+GF+   +    E   Q FNG ++            P+  +N          ++YG G   +D    F              ++VG+L+  V D  L+E F +   +V  AKVV DR +GRS+G+GFV +    E   ++  +NG+    R +R+
Sbjct:   90 LFVGNLPFSVDSAALAGLFERAGNVEIVEVIYDKLSGRSRGFGFVTMSTKEEVEAAEQQFNGYEIDGRAIRVNAGPAPAKRENSSFGGGRGGNSSYGGG---RDGNSSFGGARGGRSVDSSNRVYVGNLSWGVDDLALKELF-SEQGNVVDAKVVYDRDSGRSRGFGFVTYSSAKEVNDAIDSLNGIDLDGRSIRV 281          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: PAP1B_DICDI (Polyadenylate-binding protein 1-B OS=Dictyostelium discoideum GN=pabpc1B PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.785e-11
Identity = 49/171 (28.65%), Postives = 86/171 (50.29%), Query Frame = 2
Query:  116 IRSLWIGDLQPWMEESYIASIFGHTGE--FVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRI 622
            + SL++GDL   + E  +  +F   G     S  V R+  T  S GY ++ F ++  AER L T N T +    +  R+ W+     +R+ + G    IFV +L   V + +L +TF + + ++   KV  ++  G SKGYG+V F       +++ ++NG L   +P+ +
Sbjct:  183 LTSLYVGDLAADVNEIILNELFSKVGRNAIASIHVCRDSNTLRSLGYAYVNFFNNHDAERALDTLNYTLVHG--KPCRIMWSYRDPTKRKTNVG---NIFVKNLEKGVDNAMLYDTFSS-FGNILSCKVEFEK--GISKGYGYVHFETNDSAEKAIEKVNGTLILGKPINV 345          
The following BLAST results are available for this feature:
BLAST of CN185528 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 107
Match NameE-valueIdentityDescription
GAR2_SCHPO2.332e-1126.34Protein gar2 OS=Schizosaccharomyces pombe GN=gar2 ... [more]
ELAV3_XENTR2.332e-1126.67ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl... [more]
ELAV3_MOUSE2.332e-1125.61ELAV-like protein 3 OS=Mus musculus GN=Elavl3 PE=1... [more]
ELAV1_XENTR2.332e-1126.25ELAV-like protein 1 OS=Xenopus tropicalis GN=elavl... [more]
ROC5_NICSY3.978e-1125.7033 kDa ribonucleoprotein, chloroplastic OS=Nicotia... [more]
ROC2_NICPL6.785e-1126.5331 kDa ribonucleoprotein, chloroplastic OS=Nicotia... [more]
PAP1B_DICDI6.785e-1128.65Polyadenylate-binding protein 1-B OS=Dictyostelium... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001H18_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001H18, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185528 ID=CN185528|Name=CN185528|organism=Citrus sinensis|type=EST|length=625bp
GCAACAACATCAAACTCCGGTGCCACCTCCGGTTGGATGGACTCCGCAGC
CGGTGCCTCCTCCATCTCAGCAGACGCAGCCCTACGGTGTCGCCCCCGAT
GCTTCCTCCGACGGGATCCGTTCTTTGTGGATCGGAGACTTGCAGCCGTG
GATGGAGGAGAGTTATATCGCCAGCATCTTCGGCCATACTGGAGAGTTTG
TTTCAGGAAAGGTTATTCGCAACAAGCAAACAAATTTTTCAGAGGGTTAT
GGTTTTATTGAGTTTGTTAGTCATGCTGCTGCAGAGAGGGTTTTGCAGAC
TTTTAATGGCACCCAAATGCCAAGCACTGAGCAAAACTTCAGACTGAATT
GGGCAACCTATGGGGCTGGTGAGAGGCGTCAAGATGATGGTCCTGATTTT
ACAATTTTTGTGGGAGATTTGGCTGCCGATGTAACTGACTATGTGCTACA
AGAAACATTTAGAGCTGTCTACTCGTCAGTGAAGGGTGCTAAAGTGGTCA
CTGATAGAACCACTGGACGCTCTAAGGGGTATGGTTTTGTGAGATTTGGG
GATGAAAGTGAACAATTGCGTTCCATGACCGAAATGAATGGCGTGCTCTG
CTCTACTAGACCTATGCGGATTGGG
back to top