CN185528

Overview
NameCN185528
Unique NameCN185528
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length625
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9471 contig Csv1_Contig9471:189..813. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: TIAR_MOUSE (Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.561e-15
Identity = 56/182 (30.77%), Postives = 89/182 (48.90%), Query Frame = 2
Query:  119 RSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIR--------NKQTNFS-------EGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMR 619
            R+L++G+L   + E  I  +F   G   S K+I         N    FS       + Y F+EF  H  A   L   NG ++   E   ++NWAT  + +++ D    F +FVGDL+ ++T   ++  F A +  +  A+VV D  TG+SKGYGFV F ++ +   ++  M G     R +R
Sbjct:    9 RTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEQPDSRRVNSSVGFSVLQHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKE--VKVNWATTPSSQKK-DTSNHFHVFVGDLSPEITTEDIKSAF-APFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIR 186          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: PABP1_PONAB (Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.038e-15
Identity = 57/177 (32.20%), Postives = 88/177 (49.72%), Query Frame = 2
Query:   95 PDASSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            P A S  + SL++GDL P   E+ +   F   G  +S +V R+  T  S GY ++ F   A AER L T N   +    +  R+ W+      R+   G    IF+ +L   + +  L +TF A + ++   KVV D     SKGYGFV F  +    R++ +MNG+L + R + +G
Sbjct:    3 PSAPSYPMASLYVGDLHPDATEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKG--KPVRIMWSQRDPSLRKSGVG---NIFIKNLDKSIDNKALYDTFSA-FGNILSCKVVCDE--NGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVG 171          

HSP 2 Score: 67.0106 bits (162), Expect = 8.862e-11
Identity = 46/182 (25.27%), Postives = 93/182 (51.10%), Query Frame = 2
Query:   95 PDASSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDD----GPDFT-IFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            P     G+ +++I +L   ++   +   F   G  +S KV+ ++  N S+GYGF+ F +  AAER ++  NG  +     + ++    + + + R+ +      +FT +++ +   D+ D  L++ F   +      KV+TD + G+SKG+GFV F    +  +++ EMNG   + + + +G
Sbjct:   91 PSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDE--NGSKGYGFVHFETQEAAERAIEKMNGMLL----NDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLF-GKFGPALSVKVMTDES-GKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVG 264          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: PUB1_YEAST (Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae GN=PUB1 PE=1 SV=3)

HSP 1 Score: 81.6481 bits (200), Expect = 3.477e-15
Identity = 57/169 (33.73%), Postives = 87/169 (51.48%), Query Frame = 2
Query:  119 RSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNF-RLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRI 622
            R L++G+L   + E  +   F   G   + K++ +K  N +  Y F+E+     A   LQT NG Q+   E N  ++NWA + + +   DD   F +FVGDL  +V D  L+  F+   S + G  V+ D  TG S+GYGFV F  + +   +M  M G   + RP+RI
Sbjct:   75 RVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKN-NKNVNYAFVEYHQSHDANIALQTLNGKQI---ENNIVKINWA-FQSQQSSSDD--TFNLFVGDLNVNVDDETLRNAFKDFPSYLSG-HVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRI 235          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: PABP2_ARATH (Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 5.931e-15
Identity = 51/175 (29.14%), Postives = 93/175 (53.14%), Query Frame = 2
Query:  101 ASSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            A+  G  SL++GDL   + +S +   FG  G  V+ +V R+  T  S GYG++ F +   A R +Q  N   +P   +  R+ ++      RR   G    IF+ +L   +    L +TF + + ++   KV  D ++G+SKGYGFV++ +E    +++ ++NG+L + + + +G
Sbjct:   30 ATQFGNTSLYVGDLDFNVTDSQLFDAFGQMGTVVTVRVCRDLVTRRSLGYGYVNFTNPQDAARAIQELN--YIPLYGKPIRVMYSHRDPSVRRSGAG---NIFIKNLDESIDHKALHDTFSS-FGNIVSCKVAVD-SSGQSKGYGFVQYANEESAQKAIEKLNGMLLNDKQVYVG 197          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: TIA1_MOUSE (Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.012e-14
Identity = 52/177 (29.38%), Postives = 90/177 (50.85%), Query Frame = 2
Query:  119 RSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERR----------QDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMR 619
            ++L++G+L   + E+ I  +F   G   + K+I +   N  + Y F+EF  H  A   L   NG ++   E   ++NWAT  + +++          Q     F +FVGDL+ ++T   ++  F A +  +  A+VV D  TG+SKGYGFV F ++ +   ++ +M G     R +R
Sbjct:    7 KTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGN--DPYCFVEFHEHRHAAAALAAMNGRKIMGKE--VKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAF-APFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIR 178          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: TIA1_HUMAN (Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3)

HSP 1 Score: 80.1073 bits (196), Expect = 1.012e-14
Identity = 52/177 (29.38%), Postives = 90/177 (50.85%), Query Frame = 2
Query:  119 RSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERR----------QDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMR 619
            ++L++G+L   + E+ I  +F   G   + K+I +   N  + Y F+EF  H  A   L   NG ++   E   ++NWAT  + +++          Q     F +FVGDL+ ++T   ++  F A +  +  A+VV D  TG+SKGYGFV F ++ +   ++ +M G     R +R
Sbjct:    7 KTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGN--DPYCFVEFHEHRHAAAALAAMNGRKIMGKE--VKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAF-APFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIR 178          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: PABPA_XENLA (Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-A PE=1 SV=3)

HSP 1 Score: 80.1073 bits (196), Expect = 1.012e-14
Identity = 56/177 (31.64%), Postives = 88/177 (49.72%), Query Frame = 2
Query:   95 PDASSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            P A S  + SL++GDL   + E+ +   F   G  +S +V R+  T  S GY ++ F   A AER L T N   +    +  R+ W+      R+   G    IF+ +L   + +  L +TF A + ++   KVV D     SKGYGFV F  +    R++ +MNG+L + R + +G
Sbjct:    3 PSAPSYPMASLYVGDLHQDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKG--RPVRIMWSQRDPSLRKSGVG---NIFIKNLDKSIDNKALYDTFSA-FGNILSCKVVCDE--NGSKGYGFVHFETQEAAERAIDKMNGMLLNDRKVFVG 171          

HSP 2 Score: 68.9366 bits (167), Expect = 2.332e-11
Identity = 49/182 (26.92%), Postives = 91/182 (50.00%), Query Frame = 2
Query:   95 PDASSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDD----GPDFT-IFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            P     G+ +++I +L   ++   +   F   G  +S KV+ ++  N S+GYGF+ F +  AAER +   NG  +     + ++    + + + R+ +      +FT +++ +   D+ D  L+E F   Y      KV+TD   G+SKG+GFV F    +  +++ EMNG   + + M +G
Sbjct:   91 PSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDE--NGSKGYGFVHFETQEAAERAIDKMNGMLL----NDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGDDMNDERLKEMF-GKYGPALSVKVMTD-DNGKSKGFGFVSFERHEDAQKAVDEMNGKDMNGKSMFVG 264          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: PABP3_ARATH (Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.012e-14
Identity = 54/168 (32.14%), Postives = 88/168 (52.38%), Query Frame = 2
Query:  122 SLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            SL+ GDL P + E+++  +F H    VS +V R+ Q   S GY +I F +   A R ++  N T  P  ++  R+  +      R    G    IF+ +L A + +  L ETF + + ++   KV  D  TGRSKGYGFV+F  E     ++ ++NG+L + + + +G
Sbjct:   50 SLYAGDLDPKVTEAHLFDLFKHVANVVSVRVCRD-QNRRSLGYAYINFSNPNDAYRAMEALNYT--PLFDRPIRIMLSNRDPSTRLSGKG---NIFIKNLDASIDNKALFETFSS-FGTILSCKVAMD-VTGRSKGYGFVQFEKEESAQAAIDKLNGMLMNDKQVFVG 209          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: EPAB_XENTR (Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.012e-14
Identity = 54/170 (31.76%), Postives = 86/170 (50.59%), Query Frame = 2
Query:  116 IRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            + SL++GDL P + E+ +   F   G  +S +V R+  T  S GY +I F   A AER L T N   +    +  R+ W+    G R+   G    +F+ +L   + +  L +TF A + ++   KVV D     S+GYGFV F  +    R++  MNG+L + R + +G
Sbjct:   10 LASLYVGDLHPDVTEAMLYEKFSPAGPIMSIRVCRDIATRRSLGYAYINFQQPADAERALDTMNFEVIKG--RPIRIMWSQRDPGLRKSGVG---NVFIKNLDESIDNKALYDTFSA-FGNILSCKVVCDE--HGSRGYGFVHFETQEAANRAIQTMNGMLLNDRKVFVG 171          

HSP 2 Score: 74.7146 bits (182), Expect = 4.250e-13
Identity = 53/184 (28.80%), Postives = 93/184 (50.54%), Query Frame = 2
Query:   95 PDASSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTE------QNFRLNWATYGAGERRQDDGPDFT-IFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            P     G+ +++I +L   ++   +   F   G  +S KV+ ++    S GYGF+ F +  AA R +QT NG  +   +      ++ R     YGA         +FT +++ +   D+ D  L+E F A + +    KV+ D  TGRS+G+GFV +G+  E  ++++EMNG   + R + +G
Sbjct:   91 PGLRKSGVGNVFIKNLDESIDNKALYDTFSAFGNILSCKVVCDEHG--SRGYGFVHFETQEAANRAIQTMNGMLLNDRKVFVGHFKSRRERELEYGAKVM------EFTNVYIKNFGEDMDDKRLREIFSA-FGNTLSVKVMMD-DTGRSRGFGFVNYGNHEEAQKAVSEMNGKEVNGRMIYVG 264          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: EPABB_XENLA (Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-B PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.321e-14
Identity = 55/170 (32.35%), Postives = 85/170 (50.00%), Query Frame = 2
Query:  116 IRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            + SL+IGDL P + E+ +   F   G  +S +V R+  T  S GY +I F   A AER L T N   +    +  R+ W+    G R+   G    +F+ +L   + +  L +TF A +  +   KVV D     S+GYGFV F  +    R++  MNG+L + R + +G
Sbjct:   10 LASLYIGDLHPDVTEAMLYEKFSPAGPIMSIRVCRDIATRRSLGYAYINFQQPADAERALDTMNFEVIKG--RPIRIMWSQRDPGLRKSGVG---NVFIKNLDDSIDNKALYDTFSA-FGDILSCKVVCDEY--GSRGYGFVHFETQEAANRAIQTMNGMLLNDRKVFVG 171          

HSP 2 Score: 75.485 bits (184), Expect = 2.492e-13
Identity = 53/184 (28.80%), Postives = 94/184 (51.09%), Query Frame = 2
Query:   95 PDASSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTE------QNFRLNWATYGAGERRQDDGPDFT-IFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            P     G+ +++I +L   ++   +   F   G+ +S KV+ ++    S GYGF+ F +  AA R +QT NG  +   +      ++ R     YGA         +FT +++ +   D+ D  L+E F A + +    KV+ D + GRS+G+GFV +G+  E  +++TEMNG   + R + +G
Sbjct:   91 PGLRKSGVGNVFIKNLDDSIDNKALYDTFSAFGDILSCKVVCDEYG--SRGYGFVHFETQEAANRAIQTMNGMLLNDRKVFVGHFKSRRERELEYGAKVM------EFTNVYIKNFGEDMDDKRLKEIFSA-FGNTLSVKVMMDNS-GRSRGFGFVNYGNHEEAQKAVTEMNGKEVNGRMVYVG 264          
The following BLAST results are available for this feature:
BLAST of CN185528 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 107
Match NameE-valueIdentityDescription
TIAR_MOUSE1.561e-1530.77Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=2 SV=... [more]
PABP1_PONAB2.038e-1532.20Polyadenylate-binding protein 1 OS=Pongo abelii GN... [more]
PUB1_YEAST3.477e-1533.73Nuclear and cytoplasmic polyadenylated RNA-binding... [more]
PABP2_ARATH5.931e-1529.14Polyadenylate-binding protein 2 OS=Arabidopsis tha... [more]
TIA1_MOUSE1.012e-1429.38Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=... [more]
TIA1_HUMAN1.012e-1429.38Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=T... [more]
PABPA_XENLA1.012e-1431.64Polyadenylate-binding protein 1-A OS=Xenopus laevi... [more]
PABP3_ARATH1.012e-1432.14Polyadenylate-binding protein 3 OS=Arabidopsis tha... [more]
EPAB_XENTR1.012e-1431.76Embryonic polyadenylate-binding protein OS=Xenopus... [more]
EPABB_XENLA1.321e-1432.35Embryonic polyadenylate-binding protein B OS=Xenop... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001H18_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001H18, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185528 ID=CN185528|Name=CN185528|organism=Citrus sinensis|type=EST|length=625bp
GCAACAACATCAAACTCCGGTGCCACCTCCGGTTGGATGGACTCCGCAGC
CGGTGCCTCCTCCATCTCAGCAGACGCAGCCCTACGGTGTCGCCCCCGAT
GCTTCCTCCGACGGGATCCGTTCTTTGTGGATCGGAGACTTGCAGCCGTG
GATGGAGGAGAGTTATATCGCCAGCATCTTCGGCCATACTGGAGAGTTTG
TTTCAGGAAAGGTTATTCGCAACAAGCAAACAAATTTTTCAGAGGGTTAT
GGTTTTATTGAGTTTGTTAGTCATGCTGCTGCAGAGAGGGTTTTGCAGAC
TTTTAATGGCACCCAAATGCCAAGCACTGAGCAAAACTTCAGACTGAATT
GGGCAACCTATGGGGCTGGTGAGAGGCGTCAAGATGATGGTCCTGATTTT
ACAATTTTTGTGGGAGATTTGGCTGCCGATGTAACTGACTATGTGCTACA
AGAAACATTTAGAGCTGTCTACTCGTCAGTGAAGGGTGCTAAAGTGGTCA
CTGATAGAACCACTGGACGCTCTAAGGGGTATGGTTTTGTGAGATTTGGG
GATGAAAGTGAACAATTGCGTTCCATGACCGAAATGAATGGCGTGCTCTG
CTCTACTAGACCTATGCGGATTGGG
back to top