CN185528

Overview
NameCN185528
Unique NameCN185528
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length625
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9471 contig Csv1_Contig9471:189..813. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: RBM42_XENTR (RNA-binding protein 42 OS=Xenopus tropicalis GN=rbm42 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.109e-12
Identity = 43/113 (38.05%), Postives = 61/113 (53.98%), Query Frame = 2
Query:  284 ERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRI 622
            +R ++T  GT   S E    L W           +  DF IF GDL  +V D +L   F   Y S   AKV+ D+ TG++KGYGFV F D ++ +R+M EMNG    +RP+++
Sbjct:  269 KRCIRTAAGT---SWEDQSLLEW-----------ESDDFRIFCGDLGNEVNDDILARAFSR-YPSFLRAKVIRDKRTGKTKGYGFVSFKDPNDYVRAMREMNGKYVGSRPIKL 366          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: PABP_DEBHA (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii GN=PAB1 PE=3 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 2.109e-12
Identity = 49/173 (28.32%), Postives = 84/173 (48.55%), Query Frame = 2
Query:  107 SDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            SD   SL++G+L P + E+ +  IF   G+  S +V R+  T  S GY ++ F      E+ ++  N + +    +  R+ W+      RR  DG    IF+ +L   + +  L +TF A +  +   KV TD   G SK +GFV +        ++  +NG+L + R + +G
Sbjct:   47 SDTSASLYVGELNPSVNEALLFEIFSPIGQVASIRVCRDAVTKKSLGYAYVNFHKFEDGEKAIEDLNYSLIEG--RPCRIMWSQRDPSLRRNGDG---NIFIKNLHPAIDNKALHDTFTA-FGKILSCKVATD-DMGISKCFGFVHYETAEAAEAAIENVNGMLLNDREVYVG 212          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: ROC3_NICSY (28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.755e-12
Identity = 45/172 (26.16%), Postives = 88/172 (51.16%), Query Frame = 2
Query:  125 LWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDG------PDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRI 622
            L++G+L   ++   +A +F   G     +VI N++T+ S G+GF+   +   A++ ++ ++   +     N RL      A    + +       P + I+VG++  D+ D  L++ F + +  V  A+VV DR +GRS+G+GFV    E+E   ++  ++G     R +R+
Sbjct:   99 LFVGNLPYDIDSEGLAQLFQQAGVVEIAEVIYNRETDRSRGFGFVTMSTVEEADKAVELYSQYDL-----NGRLLTVNKAAPRGSRPERAPRTFQPTYRIYVGNIPWDIDDARLEQVF-SEHGKVVSARVVFDRESGRSRGFGFVTMSSEAEMSEAIANLDGQTLDGRTIRV 264          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: ROC4_NICSY (31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 3.598e-12
Identity = 47/172 (27.33%), Postives = 86/172 (50.00%), Query Frame = 2
Query:  125 LWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGP------DFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRI 622
            L++G+L   ++   +A +F   G     +VI N+ T+ S G+GF+   +   AE+ ++ +N   +     N RL      A    + + P       + I+VG++   + D  L++ F + +  V  A+VV DR TGRS+G+GFV    E+E   ++  ++G     R +R+
Sbjct:  138 LFVGNLPYDVDSEGLARLFEQAGVVEIAEVIYNRDTDQSRGFGFVTMSTVEEAEKAVEMYNRYDV-----NGRLLTVNKAARRGERPERPPRTFEQSYRIYVGNIPWGIDDARLEQLF-SEHGKVVSARVVYDRETGRSRGFGFVTMASEAEMSDAIANLDGQSLDGRTIRV 303          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: PABP_PHANO (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum GN=PAB1 PE=3 SV=3)

HSP 1 Score: 71.633 bits (174), Expect = 3.598e-12
Identity = 45/168 (26.79%), Postives = 83/168 (49.40%), Query Frame = 2
Query:  122 SLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            SL++G+L P + E+ +  +F   G+  S +V R+  T  S GY ++ + S    E+ L+  N T +    +  R+ W+      R+   G    +F+ +L   + +  L +TF A + ++   KV  D   G SKGYGFV +        ++  +NG+L + + + +G
Sbjct:   49 SLYVGELDPSVTEAMLFELFSSIGQVASIRVCRDAVTRRSLGYAYVNYNSSEDGEKALEELNYTVIKG--KPCRIMWSQRDPALRKTGQG---NVFIKNLDHAIDNKALHDTF-AAFGNILSCKVAQDE-LGNSKGYGFVHYETAEAANNAIKHVNGMLLNEKKVFVG 209          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: PABP_EMENI (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans GN=pab1 PE=2 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 3.598e-12
Identity = 46/168 (27.38%), Postives = 83/168 (49.40%), Query Frame = 2
Query:  122 SLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            SL++G+L P + E+ +  +F   G+  S +V R+  T  S GY ++ +   A  ER L   N T +    +  R+ W+      R+   G    +F+ +L + + +  L +TF A + ++   KV  D   G SKGYGFV +        ++  +NG+L + + + +G
Sbjct:   43 SLYVGELDPSVTEAMLYELFSSIGQVASIRVCRDAVTRRSLGYAYVNYNDTAHGERALDELNYTLIKG--KPCRIMWSQRDPALRKTGQG---NVFIKNLDSAIDNKALHDTF-AAFGNILSCKVAQDE-FGVSKGYGFVHYETAEAANNAIKHVNGMLLNDKKVFVG 203          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: ROC1_NICSY (29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.699e-12
Identity = 52/191 (27.23%), Postives = 86/191 (45.03%), Query Frame = 2
Query:   86 GVAPDASSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQM------------PSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRI 622
            GV  + +      +++G+L    + + +A +F   G     +VI +K T  S G+GF+   S    E   Q FNG ++            P   +N      + G G     +     ++VG+LA  V    L ET  +    V  AKVV DR +GRS+G+GFV +    E   ++  ++GV  + R +R+
Sbjct:   76 GVEEERNFSPDLKIFVGNLPFSADSAALAELFERAGNVEMVEVIYDKLTGRSRGFGFVTMSSKEEVEAACQQFNGYELDGRALRVNSGPPPEKRENSSFRGGSRGGGSFDSSN----RVYVGNLAWGVDQDAL-ETLFSEQGKVVDAKVVYDRDSGRSRGFGFVTYSSAEEVNNAIESLDGVDLNGRAIRV 261          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: RBM42_DANRE (RNA-binding protein 42 OS=Danio rerio GN=rbm42 PE=2 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 4.699e-12
Identity = 36/76 (47.37%), Postives = 49/76 (64.47%), Query Frame = 2
Query:  395 DFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRI 622
            DF IF GDL  +V D +L   F   Y S   AKVV D+ TG++KGYGFV F D ++ +R+M EMNG    +RP+++
Sbjct:  302 DFRIFCGDLGNEVNDDILARAFSR-YPSFLKAKVVRDKRTGKTKGYGFVSFKDPNDYVRAMREMNGRYVGSRPIKL 376          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: PABP_YARLI (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica GN=PAB1 PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.699e-12
Identity = 46/168 (27.38%), Postives = 82/168 (48.81%), Query Frame = 2
Query:  122 SLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            SL++G+L P + E+ +  IF   G   S +V R+  T  S GY ++ F + A   R L+  N    P  E+  R+ W+      R+   G    I++ +L   + +  L +TF A +  +   K+ TD   G S+G+GFV +        ++  +NG+L + + + +G
Sbjct:   47 SLYVGELDPSVTEAMLFEIFNPIGPVTSVRVCRDAITRRSLGYAYVNFHNQADGIRALEELN--YSPIKERPCRIMWSQRDPALRKTGAG---NIYIKNLDPAIDNKALHDTFSA-FGQILSCKIATDE-FGNSRGFGFVHYESAESAESAIQHVNGMLLNDKKVFVG 207          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: PABP_SCHPO (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe GN=pab1 PE=1 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 4.699e-12
Identity = 46/177 (25.99%), Postives = 83/177 (46.89%), Query Frame = 2
Query:   95 PDASSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            P  ++    SL++G+L P + E+ +  +F   G   S +V R+  T  S GY ++ F +    E+ L   N T +    +  R+ W+      R+   G    +F+ +L   + +  L +TF A +  +   KV  D   G +KGYGFV F        ++  +NG+L + + + +G
Sbjct:   72 PSGTAPTSASLYVGELDPSVTEAMLFELFNSIGPVASIRVCRDAVTRRSLGYAYVNFHNMEDGEKALDELNYTLIKG--RPCRIMWSQRDPSLRKMGTG---NVFIKNLDPAIDNKALHDTFSA-FGKILSCKVAVDE-LGNAKGYGFVHFDSVESANAAIEHVNGMLLNDKKVYVG 241          
The following BLAST results are available for this feature:
BLAST of CN185528 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 107
Match NameE-valueIdentityDescription
RBM42_XENTR2.109e-1238.05RNA-binding protein 42 OS=Xenopus tropicalis GN=rb... [more]
PABP_DEBHA2.109e-1228.32Polyadenylate-binding protein, cytoplasmic and nuc... [more]
ROC3_NICSY2.755e-1226.1628 kDa ribonucleoprotein, chloroplastic OS=Nicotia... [more]
ROC4_NICSY3.598e-1227.3331 kDa ribonucleoprotein, chloroplastic OS=Nicotia... [more]
PABP_PHANO3.598e-1226.79Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_EMENI3.598e-1227.38Polyadenylate-binding protein, cytoplasmic and nuc... [more]
ROC1_NICSY4.699e-1227.2329 kDa ribonucleoprotein A, chloroplastic OS=Nicot... [more]
RBM42_DANRE4.699e-1247.37RNA-binding protein 42 OS=Danio rerio GN=rbm42 PE=... [more]
PABP_YARLI4.699e-1227.38Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_SCHPO4.699e-1225.99Polyadenylate-binding protein, cytoplasmic and nuc... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001H18_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001H18, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185528 ID=CN185528|Name=CN185528|organism=Citrus sinensis|type=EST|length=625bp
GCAACAACATCAAACTCCGGTGCCACCTCCGGTTGGATGGACTCCGCAGC
CGGTGCCTCCTCCATCTCAGCAGACGCAGCCCTACGGTGTCGCCCCCGAT
GCTTCCTCCGACGGGATCCGTTCTTTGTGGATCGGAGACTTGCAGCCGTG
GATGGAGGAGAGTTATATCGCCAGCATCTTCGGCCATACTGGAGAGTTTG
TTTCAGGAAAGGTTATTCGCAACAAGCAAACAAATTTTTCAGAGGGTTAT
GGTTTTATTGAGTTTGTTAGTCATGCTGCTGCAGAGAGGGTTTTGCAGAC
TTTTAATGGCACCCAAATGCCAAGCACTGAGCAAAACTTCAGACTGAATT
GGGCAACCTATGGGGCTGGTGAGAGGCGTCAAGATGATGGTCCTGATTTT
ACAATTTTTGTGGGAGATTTGGCTGCCGATGTAACTGACTATGTGCTACA
AGAAACATTTAGAGCTGTCTACTCGTCAGTGAAGGGTGCTAAAGTGGTCA
CTGATAGAACCACTGGACGCTCTAAGGGGTATGGTTTTGTGAGATTTGGG
GATGAAAGTGAACAATTGCGTTCCATGACCGAAATGAATGGCGTGCTCTG
CTCTACTAGACCTATGCGGATTGGG
back to top