CN185528

Overview
NameCN185528
Unique NameCN185528
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length625
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9471 contig Csv1_Contig9471:189..813. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: PAB4L_HUMAN (Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.699e-12
Identity = 50/159 (31.45%), Postives = 82/159 (51.57%), Query Frame = 2
Query:  122 SLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVL 598
            SL++GDL   + E  +   F   G  +S ++ R++ T  S GY ++ F+  A A++ L T N   +    ++ RL W+   A  RR   G    +F+ +L   + +  L E F A +  +  +KV++D     SKGY FV F ++S   R++ EMNG L
Sbjct:   11 SLYVGDLHADVTEDLLFRKFSTVGPVLSIRICRDQVTRRSLGYAYVNFLQLADAQKALDTMNFDIIKG--KSIRLMWSQRDAYLRRSGIG---NVFIKNLDKSIDNKTLYEHFSA-FGKILSSKVMSD--DQGSKGYAFVHFQNQSAADRAIEEMNGKL 161          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: ELAV3_XENLA (ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.699e-12
Identity = 43/163 (26.38%), Postives = 83/163 (50.92%), Query Frame = 2
Query:  104 SSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNG 592
            + D   +L +  L   M +    S+FG  GE  S K++R+K T  S GYGF+ +V    A++ + T NG ++ +  +  ++++A   +   R     D  ++V  L   +    +++ F + Y  +  ++++ D+ TG S+G GF+RF    E   ++  +NG
Sbjct:   29 ADDSKTNLIVNYLPQNMTQEEFKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYVDPNDADKAINTLNGLKLQT--KTIKVSYARPSSASIR-----DANLYVSSLPKTMNQKEMEQLF-SQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNG 183          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: ELAV2_XENLA (ELAV-like protein 2 OS=Xenopus laevis GN=elavl2 PE=1 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 4.699e-12
Identity = 46/169 (27.22%), Postives = 87/169 (51.48%), Query Frame = 2
Query:   89 VAPDASSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNF-SEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNG 592
            V  + + D   +L +  L   M +  + S+FG  GE  S K++R+K T   S GYGF+ ++    AE+ + T NG ++ +  +  ++++A   +   R     D  ++V  L   +T   L++ F + Y  +  ++++ D+ TG S+G GF+RF    E   ++  +NG
Sbjct:   56 VESNNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITEGQSLGYGFVNYIDPKDAEKAINTLNGLRLQT--KTIKVSYARPSSASIR-----DANLYVSGLPKTMTQKELEQLF-SQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNG 216          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: ROC1_NICPL (30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 6.137e-12
Identity = 54/193 (27.98%), Postives = 87/193 (45.08%), Query Frame = 2
Query:   86 GVAPDASSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQM------------PSTEQN--FRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRI 622
            GV  + +      +++G+L    + + +A +F   G     +VI +K T  S G+GF+   S    E   Q FNG ++            P   +N  FR N +  G             ++VG+LA  V    L ET  +    V  AKVV DR +GRS+G+GFV +    E   ++  ++GV  + R +R+
Sbjct:   76 GVEEERNFSPDLKIFVGNLLFSADSAALAELFERAGNVEMVEVIYDKLTGRSRGFGFVTMSSKEEVEAACQQFNGYELDGRALRVNSGPPPEKRENSSFRENSSFRGGSRGGGSFDSSNRVYVGNLAWGVDQDAL-ETLFSEQGKVVDAKVVYDRDSGRSRGFGFVTYSSAEEVNNAIESLDGVDLNGRAIRV 267          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: PABP_CANAL (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans GN=PAB1 PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 6.137e-12
Identity = 46/168 (27.38%), Postives = 83/168 (49.40%), Query Frame = 2
Query:  122 SLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            SL++G+L P + E+ +  IF   G+  S +V R+  +  S GY ++ +  +   E+ ++  N    P   +  R+ W+      RR  DG    IF+ +L   + +  L +TF A +  +   KV TD   G+SK +GFV +        ++  +NG+L + R + +G
Sbjct:   53 SLYVGELNPSVNEATLFEIFSPIGQVSSIRVCRDAVSKKSLGYAYVNYHKYEDGEKAIEELN--YNPIEGRPCRIMWSQRDPSARRSGDG---NIFIKNLHPAIDNKALHDTFSA-FGKILSCKVATDE-FGQSKCFGFVHYETAEAAEAAIENVNGMLLNDREVFVG 213          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: PABPX_ARATH (Probable polyadenylate-binding protein At2g36660 OS=Arabidopsis thaliana GN=At2g36660 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 6.137e-12
Identity = 50/183 (27.32%), Postives = 87/183 (47.54%), Query Frame = 2
Query:   92 APDASSDG-----IRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            A DASS G       SL++GDL P + E  +   F       S ++ ++  +  S  YG+  F+S   A   ++  N + +    +  R+ W+      RR   G    +FV +L   VT+ VLQ+ F+  + ++   KV T    G+S+GYGFV+F  E     ++  +N  + + + + +G
Sbjct:   10 AADASSSGSSSPVTASLYVGDLHPSVTEGILYDAFAEFKSLTSVRLCKDASSGRSLCYGYANFLSRQDANLAIEKKNNSLL--NGKMIRVMWSVRAPDARRNGVG---NVFVKNLPESVTNAVLQDMFKK-FGNIVSCKVAT-LEDGKSRGYGFVQFEQEDAAHAAIQTLNSTIVADKEIYVG 185          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: NSR1_YEAST (Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae GN=NSR1 PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 6.137e-12
Identity = 41/173 (23.70%), Postives = 89/173 (51.45%), Query Frame = 2
Query:  122 SLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWA-TYGAGERRQDDG-----PDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRI 622
            ++++G L   +++ ++   F H G  +  +VI  + T+ S GYG+++F + + AE+ +Q   G ++     N  ++ +   G  +R +  G     P  T+F+G+L+ +     + E F A +  V   ++ T   T + KG+G+V+F +  +  +++  + G     RP+R+
Sbjct:  169 TIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELF-AKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRL 340          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: ROC2_NICSY (29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.047e-11
Identity = 54/196 (27.55%), Postives = 90/196 (45.92%), Query Frame = 2
Query:  125 LWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQM------------PSTEQNFRLNW-----ATYGAGERRQDDGPDF-------------TIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRI 622
            L++G+L   ++ + +A +F   G     +VI +K T  S G+GF+   +    E   Q FNG ++            P+  +N          ++YG G   +D    F              ++VG+L+  V D  L+E F +   +V  AKVV DR +GRS+G+GFV +    E   ++  +NGV    R +R+
Sbjct:   89 LFVGNLPFSVDSAALAGLFERAGNVEMVEVIYDKLTGRSRGFGFVTMSTKEEVEAAEQQFNGYEIDGRAIRVNAGPAPAKRENSSFGGGRGGNSSYGGG---RDGNSSFGGARGGRSVDSSNRVYVGNLSWGVDDLALKELF-SEQGNVVDAKVVYDRDSGRSRGFGFVTYSSSKEVNDAIDSLNGVDLDGRSIRV 280          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: ELV1B_XENLA (ELAV-like protein 1-B OS=Xenopus laevis GN=elavl1-B PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.047e-11
Identity = 43/160 (26.88%), Postives = 80/160 (50.00%), Query Frame = 2
Query:  113 GIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNG 592
            G  +L +  L   M +  + S+F   GE  S K+IR+K    S GYGF+ +++   AER + T NG ++ S  +  ++++A         +   D  +++  L   +T   +++ F   +  +  ++V+ D+ TG S+G  F+RF   SE   ++   NG
Sbjct:   18 GRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYLNAKDAERAINTLNGLRLQS--KTIKVSFA-----RPSSETIKDANLYISGLPRTMTQKDVEDMF-LPFGHIINSRVLVDQATGLSRGVAFIRFDKRSEAEEAIASFNG 169          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: SXL_MEGSC (Sex-lethal homolog OS=Megaselia scalaris GN=SXL PE=2 SV=3)

HSP 1 Score: 69.3218 bits (168), Expect = 1.786e-11
Identity = 42/159 (26.42%), Postives = 82/159 (51.57%), Query Frame = 2
Query:  152 MEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVL--CSTRPMRI 622
            M++  + S+F   G   + +++R+ +T +S GYGF++F S A A R +   NG  +    +  ++++A  G  + R     D  ++V +L+  +TD  L ET    Y  +    ++ D+ TG  +G  F+RF    E   +++ +N V+    T+P+ +
Sbjct:   89 MQDRELYSLFRTIGPINTCRIMRDYKTGYSYGYGFVDFGSEADALRAINNLNGITV--RNKRIKVSFARPGGEQLR-----DTNLYVTNLSRSITDEQL-ETIFGKYGQIVQKNILRDKHTGTPRGVAFIRFNKREEAQEAISALNNVIPEGGTQPLTV 239          
The following BLAST results are available for this feature:
BLAST of CN185528 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 107
Match NameE-valueIdentityDescription
PAB4L_HUMAN4.699e-1231.45Polyadenylate-binding protein 4-like OS=Homo sapie... [more]
ELAV3_XENLA4.699e-1226.38ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE... [more]
ELAV2_XENLA4.699e-1227.22ELAV-like protein 2 OS=Xenopus laevis GN=elavl2 PE... [more]
ROC1_NICPL6.137e-1227.9830 kDa ribonucleoprotein, chloroplastic OS=Nicotia... [more]
PABP_CANAL6.137e-1227.38Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABPX_ARATH6.137e-1227.32Probable polyadenylate-binding protein At2g36660 O... [more]
NSR1_YEAST6.137e-1223.70Nuclear localization sequence-binding protein OS=S... [more]
ROC2_NICSY1.047e-1127.5529 kDa ribonucleoprotein B, chloroplastic OS=Nicot... [more]
ELV1B_XENLA1.047e-1126.88ELAV-like protein 1-B OS=Xenopus laevis GN=elavl1-... [more]
SXL_MEGSC1.786e-1126.42Sex-lethal homolog OS=Megaselia scalaris GN=SXL PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001H18_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001H18, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185528 ID=CN185528|Name=CN185528|organism=Citrus sinensis|type=EST|length=625bp
GCAACAACATCAAACTCCGGTGCCACCTCCGGTTGGATGGACTCCGCAGC
CGGTGCCTCCTCCATCTCAGCAGACGCAGCCCTACGGTGTCGCCCCCGAT
GCTTCCTCCGACGGGATCCGTTCTTTGTGGATCGGAGACTTGCAGCCGTG
GATGGAGGAGAGTTATATCGCCAGCATCTTCGGCCATACTGGAGAGTTTG
TTTCAGGAAAGGTTATTCGCAACAAGCAAACAAATTTTTCAGAGGGTTAT
GGTTTTATTGAGTTTGTTAGTCATGCTGCTGCAGAGAGGGTTTTGCAGAC
TTTTAATGGCACCCAAATGCCAAGCACTGAGCAAAACTTCAGACTGAATT
GGGCAACCTATGGGGCTGGTGAGAGGCGTCAAGATGATGGTCCTGATTTT
ACAATTTTTGTGGGAGATTTGGCTGCCGATGTAACTGACTATGTGCTACA
AGAAACATTTAGAGCTGTCTACTCGTCAGTGAAGGGTGCTAAAGTGGTCA
CTGATAGAACCACTGGACGCTCTAAGGGGTATGGTTTTGTGAGATTTGGG
GATGAAAGTGAACAATTGCGTTCCATGACCGAAATGAATGGCGTGCTCTG
CTCTACTAGACCTATGCGGATTGGG
back to top