CN185249

Overview
NameCN185249
Unique NameCN185249
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length333
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2005 contig Csv1_Contig2005:289..621. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_COCIM (Autophagy-related protein 8 OS=Coccidioides immitis GN=ATG8 PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 5.028e-15
Identity = 38/51 (74.51%), Postives = 43/51 (84.31%), Query Frame = -3
Query:  179 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFGS 331
            RIKLS EKAIFIFVD VLPPT A+ S+IYEE KD+DGFLY+T SG N FG+
Sbjct:   67 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDDDGFLYITYSGENTFGN 117          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8D_ARATH (Autophagy-related protein 8d OS=Arabidopsis thaliana GN=ATG8D PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.567e-15
Identity = 39/50 (78.00%), Postives = 42/50 (84.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RIKLS EKAIFIFV N+LPPT AI SAIYEE KDEDGFLY++ SG N FG
Sbjct:   68 RIKLSPEKAIFIFVKNILPPTAAIMSAIYEEHKDEDGFLYMSYSGENTFG 117          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8C_ARATH (Autophagy-related protein 8c OS=Arabidopsis thaliana GN=ATG8C PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.567e-15
Identity = 38/50 (76.00%), Postives = 42/50 (84.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RIKLSAEKAIF+FV N LPPT A+ SAIY+E KDEDGFLY+T SG N FG
Sbjct:   68 RIKLSAEKAIFVFVKNTLPPTAAMMSAIYDENKDEDGFLYMTYSGENTFG 117          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8B_ORYSJ (Autophagy-related protein 8B OS=Oryza sativa subsp. japonica GN=ATG8B PE=3 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 6.567e-15
Identity = 39/50 (78.00%), Postives = 41/50 (82.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RIKLS EKAIFIFV N LPPT A+ SAIYEE KDEDGFLY+T SG N FG
Sbjct:   68 RIKLSPEKAIFIFVKNTLPPTAALMSAIYEENKDEDGFLYMTYSGENTFG 117          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8B_ORYSI (Autophagy-related protein 8B OS=Oryza sativa subsp. indica GN=ATG8B PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.567e-15
Identity = 39/50 (78.00%), Postives = 41/50 (82.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RIKLS EKAIFIFV N LPPT A+ SAIYEE KDEDGFLY+T SG N FG
Sbjct:   68 RIKLSPEKAIFIFVKNTLPPTAALMSAIYEENKDEDGFLYMTYSGENTFG 117          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8A_ORYSJ (Autophagy-related protein 8A OS=Oryza sativa subsp. japonica GN=ATG8A PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.567e-15
Identity = 38/51 (74.51%), Postives = 42/51 (82.35%), Query Frame = -3
Query:  179 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFGS 331
            RIKLS EKAIF+FV N LPPT ++ SAIYEE KDEDGFLY+T SG N FGS
Sbjct:   68 RIKLSPEKAIFVFVKNTLPPTASLMSAIYEENKDEDGFLYMTYSGENTFGS 118          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8A_ORYSI (Autophagy-related protein 8A OS=Oryza sativa subsp. indica GN=ATG8A PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.567e-15
Identity = 38/51 (74.51%), Postives = 42/51 (82.35%), Query Frame = -3
Query:  179 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFGS 331
            RIKLS EKAIF+FV N LPPT ++ SAIYEE KDEDGFLY+T SG N FGS
Sbjct:   68 RIKLSPEKAIFVFVKNTLPPTASLMSAIYEENKDEDGFLYMTYSGENTFGS 118          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_SCLS1 (Autophagy-related protein 8 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg8 PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 8.577e-15
Identity = 38/50 (76.00%), Postives = 42/50 (84.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RIKLS EKAIFIFVD VLPPT A+ S+IYEE KDEDGFLY++ SG N FG
Sbjct:   67 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYISYSGENTFG 116          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_SCHPO (Autophagy-related protein 8 OS=Schizosaccharomyces pombe GN=atg8 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 8.577e-15
Identity = 37/54 (68.52%), Postives = 42/54 (77.78%), Query Frame = -3
Query:  170 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFGSHIP 331
            RIKLS EKAIFIF+D +LPPT A+ S IYEE K EDGFLY+T SG N FG+  P
Sbjct:   67 RIKLSPEKAIFIFIDEILPPTAALMSTIYEEHKSEDGFLYITYSGENTFGTVFP 120          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_BOTFB (Autophagy-related protein 8 OS=Botryotinia fuckeliana (strain B05.10) GN=atg8 PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 8.577e-15
Identity = 38/50 (76.00%), Postives = 42/50 (84.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RIKLS EKAIFIFVD VLPPT A+ S+IYEE KDEDGFLY++ SG N FG
Sbjct:   67 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYISYSGENTFG 116          
The following BLAST results are available for this feature:
BLAST of CN185249 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 49
Match NameE-valueIdentityDescription
ATG8_COCIM5.028e-1574.51Autophagy-related protein 8 OS=Coccidioides immiti... [more]
ATG8D_ARATH6.567e-1578.00Autophagy-related protein 8d OS=Arabidopsis thalia... [more]
ATG8C_ARATH6.567e-1576.00Autophagy-related protein 8c OS=Arabidopsis thalia... [more]
ATG8B_ORYSJ6.567e-1578.00Autophagy-related protein 8B OS=Oryza sativa subsp... [more]
ATG8B_ORYSI6.567e-1578.00Autophagy-related protein 8B OS=Oryza sativa subsp... [more]
ATG8A_ORYSJ6.567e-1574.51Autophagy-related protein 8A OS=Oryza sativa subsp... [more]
ATG8A_ORYSI6.567e-1574.51Autophagy-related protein 8A OS=Oryza sativa subsp... [more]
ATG8_SCLS18.577e-1576.00Autophagy-related protein 8 OS=Sclerotinia sclerot... [more]
ATG8_SCHPO8.577e-1568.52Autophagy-related protein 8 OS=Schizosaccharomyces... [more]
ATG8_BOTFB8.577e-1576.00Autophagy-related protein 8 OS=Botryotinia fuckeli... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001A19_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001A19, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185249 ID=CN185249|Name=CN185249|organism=Citrus sinensis|type=EST|length=333bp
CTTATATCCAATAGGTAACTGTACATATTATCACTGGCAATGTCTTTATA
AAATATAAAATATGCCCGATAAAGGAATATTCAGCGGAAAGCAAGGATGA
CAATTGAGATAAAAATGCCGTCGCCCCAAAAACCACTCAATGAGCGGATA
GATAATCACAAGGCTAAACTGGGATGTGGCTTCCAAATGGGTTCCCCCCA
CTGGGAGTCACATAAAGAAAACCATCTTCATCCTTTTTCTCTTCGTATAT
GGCAGACCTAATTGCACCGGTAGGTGGGAGCACATTATCCACAAAAATAA
ATATCGCCTTTTCAGCACTCAGTTTGATCCTTT
back to top